Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR869 IGR870 IGR868 IGR867 IGR871 IGR866 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 HD1183 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 HD1183 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 HD1183 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185
* Calculated from Protein Sequence

Gene ID: HD1187

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lpxA  

Definition:
acyl-(acyl-carrier-protein)-UDP-N-acetylglucosamine

Gene Start:
967161

Gene Stop:
966367

Gene Length:
795

Molecular Weight*:
28871

pI*:
7.50

Net Charge*:
2.70

EC:
2.3.1.129  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Secondary Evidence:
Servos,S., Khan,S. and Maskell,D.
Cloning and expression of genes encoding lipid A biosynthesis from
Haemophilus influenzae type b
Gene 175 (1-2), 137-141 (1996)
M:97074663

Coleman,J. and Raetz,C.R.
First committed step of lipid A biosynthesis in Escherichia coli:
sequence of the lpxA gene
J. Bacteriol. 170 (3), 1268-1274 (1988)
M:88139188

Crowell,D.N., Reznikoff,W.S. and Raetz,C.R.
Nucleotide sequence of the Escherichia coli gene for lipid A
disaccharide synthase
J. Bacteriol. 169 (12), 5727-5734 (1987)
M:88058790


Comment:
For other "lpx" genes, see HD1189 (lpxD), HD0816 (lpxC), HD0846 (lpxB).

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to acyl-(acyl-carrier-protein)-UDP-N-acetylglucosamine O-acyltransferase from H. influenzae (1170826), E. coli (2506337), Yersinia enterocolitica (417259), among others.

HD is similar to acyl-(acyl-carrier-protein)- UDP-N-acetylglucosamine O-acyltransferase from C. pneumoniae (CPn0650, CPn0302) and C. trachomatis (CT531, CT243). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1043
COG name: Acyl-[acyl carrier protein]--UDP-N-acetylglucosamine O-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1043 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 2.8e-12.
    IPB001451    149-184
    IPB001451    16-51
    IPB001451    4-39
    IPB001451    131-166
    IPB001451    10-45
    IPB001451    22-57
    IPB001451    28-63
    IPB001451    34-69
    IPB001451    113-148
    IPB001451    119-154


ProDom Summary:  Protein Domain Search
Residues 196-264 are 76% similar to a (ACYLTRANSFERASE PROTEOME COMPLETE) protein domain (PD007405) which is seen in Q9CJK8_PASMU.

Residues 71-127 are 82% similar to a (ACYLTRANSFERASE LIPID) protein domain (PD228415) which is seen in LPXA_ECOLI.

Residues 10-70 are 57% similar to a (LIPID ACYLTRANSFERASE BIOSYNTHESIS) protein domain (PD402916) which is seen in LPXA_ECOLI.

Residues 199-263 are 61% similar to a (ACYLTRANSFERASE LIPID) protein domain (PD242784) which is seen in LPXA_YEREN.

Residues 65-260 are 34% similar to a (LIPID ACYLTRANSFERASE O-ACYLTRANSFERASE) protein domain (PD088547) which is seen in LPXA_BRUAB.

Residues 128-192 are 70% similar to a (ACYLTRANSFERASE LIPID O-ACYLTRANSFERASE) protein domain (PD395079) which is seen in LPXA_ECOLI.

Residues 8-70 are 58% similar to a (ACYLTRANSFERASE PROTEOME COMPLETE) protein domain (PD359885) which is seen in LPXA_SALTY.

Residues 109-195 are 83% similar to a (COMPLETE PROTEOME TRANSFERASE ACYLTRANSFERASE LIPID) protein domain (PD000343) which is seen in LPXA_HAEIN.



Paralogs:  Local Blast Search


HD1187 is paralogously related to HD1189 (5e-13).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1LXA| Udp N-Acetylglucosamine Acyltransferase 387 7e-109

Gene Protein Sequence:
MRLIDSTAKISPLAVIEDGAQIGAHVEIGPFCVIGKNVKIDAKTILHSHV
VINGHTEIGEQNQIFQFASIGEINQDLKYQGEPTKVVIGDRNSIRESVTI
HRGTVQGGGVTRIGNDNLFMINAHIAHDCNISNHCIIANNGTLAGHVRLD
DFVIVGGMSAIHQFVIIGSHVMLGGGSMVSQDVPPYVMAQGNHAQPFGVN
LEGLKRRGFDKPTMHAIRHVYKLIYRSGKTIEEVLPEIEHIALNEPAIKV
YLDFFKHSTRGIIR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGATTAATCGATTCTACGGCTAAAATCAGTCCATTAGCTGTTATAGA
AGACGGTGCTCAAATTGGTGCTCATGTGGAAATTGGTCCATTTTGCGTTA
TTGGTAAAAATGTCAAAATTGATGCTAAAACAATTCTTCATTCACATGTT
GTGATCAATGGCCATACTGAGATAGGTGAACAAAACCAAATTTTTCAATT
CGCTAGCATTGGCGAAATTAACCAAGACTTAAAATATCAAGGTGAACCCA
CAAAAGTAGTTATTGGTGATCGGAATAGTATTCGCGAAAGTGTAACTATT
CATCGTGGTACTGTCCAAGGCGGTGGCGTAACACGAATTGGTAATGATAA
TTTATTTATGATCAATGCGCATATTGCTCATGATTGTAATATTAGTAACC
ACTGTATTATTGCTAATAATGGTACATTGGCAGGCCATGTCAGATTAGAT
GATTTTGTGATTGTAGGTGGAATGTCTGCTATCCATCAATTTGTTATTAT
CGGCTCACACGTTATGTTAGGCGGTGGTTCAATGGTCAGTCAAGATGTTC
CCCCATATGTGATGGCACAAGGTAATCATGCACAACCATTTGGCGTAAAT
TTAGAAGGCTTAAAACGACGTGGATTTGATAAGCCAACAATGCACGCGAT
CCGCCATGTTTATAAATTAATCTATCGTAGCGGCAAAACAATTGAGGAAG
TATTACCAGAAATTGAACATATTGCACTAAATGAACCGGCAATAAAAGTC
TATCTTGATTTCTTCAAACATTCCACACGTGGCATTATTCGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy