Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR869 IGR865 IGR870 IGR868 IGR867 IGR871 IGR866 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 rfaE,rbsK, - HD1182 HD1183 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 rfaE,rbsK, - HD1182 HD1183 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 rfaE,rbsK, - HD1182 HD1183 D15, - HD1191 dxr, - HD1186 ppG,relA, - HD1185
* Calculated from Protein Sequence

Gene ID: HD1186

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dxr  

Definition:
1-deoxy-D-xylulose 5-phosphate reductoisomerase

Gene Start:
965107

Gene Stop:
966297

Gene Length:
1191

Molecular Weight*:
42927

pI*:
5.50

Net Charge*:
-7.24

EC:
1.1.1.267  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Sterol biosynthesis

Secondary Evidence:
Takahashi,S., Kuzuyama,T., Watanabe,H. and Seto,H.
A 1-deoxy-D-xylulose 5-phosphate reductoisomerase catalyzing the
formation of 2-C-methyl-D-erythritol 4-phosphate in an alternative
nonmevalonate pathway for terpenoid biosynthesis
Proc. Natl. Acad. Sci. U.S.A. 95 (17), 9879-9884 (1998)
MEDLINE: 98374274

Radykewicz,T., Rohdich,F., Wungsintaweekul,J., Herz,S., Kis,K.,
Eisenreich,W., Bacher,A., Zenk,M.H. and Arigoni,D.
Biosynthesis of terpenoids: 1-deoxy-D-xylulose-5-phosphate
reductoisomerase from Escherichia coli is a class B dehydrogenase
FEBS Lett. 465 (2-3), 157-160 (2000)
MEDLINE: 20123893

Kuzuyama,T., Takahashi,S., Takagi,M. and Seto,H.
Characterization of 1-deoxy-D-xylulose 5-phosphate
reductoisomerase, an enzyme involved in isopentenyl diphosphate
biosynthesis, and identification of its catalytic amino acid
residues
J. Biol. Chem. 275 (26), 19928-19932 (2000)
MEDLINE: 20347905



Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to 1-deoxy-D-xylulose 5-phosphate reduductoisomerase (DXP reductoisomerase) from H. influenzae (1175511), E. coli (2506592), Neisseria meningitidis (7378856), among others.

HD1186 is similar to conserved hypothetical protein from C. pneumoniae (CPn0345), C. trachomatis (CT071), and T. pallidum (TP0601). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0743
COG name: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (terpenoid biosynthesis)
Functional Class: I
The phylogenetic pattern of COG0743 is -----qvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003821 (1-deoxy-D-xylulose 5-phosphate reductoisomerase) with a combined E-value of 5.9e-119.
    IPB003821A    6-20
    IPB003821B    97-132
    IPB003821C    201-239
    IPB003821D    246-289
    IPB003821E    334-356


ProDom Summary:  Protein Domain Search
Residues 85-390 are 77% similar to a (REDUCTOISOMERASE 5-PHOSPHATE) protein domain (PD010039) which is seen in DXR_HAEIN.

Residues 1-83 are 60% similar to a (REDUCTOISOMERASE 5-PHOSPHATE) protein domain (PD186282) which is seen in DXR_PASMU.



Paralogs:  Local Blast Search
HD1186 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 389 (E-value = 3.1e-238) place HD1186 in the DXP_reductoisom family which is described as 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKNIVILGATGSIGQSTLSVIEHNPDQYQVFALVGGKNVELMATQCSQFK
PKFAALVDEKAAKLLAEQLKALNLTTQVLTGEQAICELAAHPDANIVMAA
IVGAAGLLPTLAAVKAGKQILLANKESLVTCGQIFIDEARKSGATLLPVD
SEHNAIFQSLPLVAQQKIGFCPLAELGVSRIILTGSGGPFREKSLAEFDS
ITPEQAIAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASVEEMEIII
HPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAHTMAYPNRIPSGVMPLDFG
KLTELTFIEPDFKRYPNLKLAIEASAEGQYATTALNAANEIAVDAFLNRQ
IRFTEIERINSTVVENIAPLRVNDVADVLHIDQLAREIAKQAMLNV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAACATAGTAATTTTGGGAGCAACAGGTTCAATTGGTCAAAGTAC
ATTATCAGTGATTGAGCATAATCCTGACCAGTATCAAGTGTTTGCACTTG
TTGGAGGAAAAAATGTTGAATTAATGGCTACACAATGTAGCCAATTTAAG
CCTAAATTTGCCGCGTTAGTAGATGAAAAGGCTGCAAAATTGCTTGCTGA
ACAATTAAAAGCATTGAATTTAACCACCCAAGTATTAACCGGCGAACAAG
CTATTTGTGAATTAGCGGCACATCCTGACGCGAATATAGTTATGGCAGCG
ATTGTTGGTGCGGCAGGTTTACTACCTACCTTAGCAGCAGTTAAGGCAGG
CAAACAAATATTATTAGCAAATAAAGAATCTTTAGTGACATGCGGGCAAA
TTTTTATTGATGAGGCGCGTAAATCAGGGGCAACATTGTTGCCGGTCGAC
AGTGAACATAATGCAATTTTTCAATCTCTACCACTAGTGGCACAACAAAA
AATAGGATTTTGTCCGTTAGCTGAATTAGGCGTCAGCCGTATTATTTTGA
CCGGTTCAGGTGGCCCATTTCGAGAAAAAAGTTTAGCTGAATTTGATTCT
ATTACCCCTGAGCAAGCTATTGCGCATCCAAATTGGTCGATGGGTAAAAA
GATTTCCGTTGACTCAGCCACAATGATGAATAAAGGATTAGAATATATTG
AGGCACGCTGGCTATTTAACGCAAGTGTCGAAGAAATGGAAATTATTATT
CATCCACAATCGATTATTCATTCTATGGTGCGTTATATTGATGGATCTGT
CATTGCTCAAATGGGAAATCCTGATATGAGAACCCCTATTGCACATACAA
TGGCATATCCAAACCGTATTCCATCAGGCGTTATGCCATTAGATTTTGGT
AAATTAACAGAATTAACCTTTATTGAGCCTGATTTCAAGCGCTATCCTAA
TTTGAAATTAGCGATTGAAGCATCTGCTGAAGGGCAATATGCGACTACAG
CATTAAATGCGGCGAATGAAATTGCTGTAGACGCCTTTTTAAATCGTCAG
ATTCGTTTTACTGAGATAGAACGTATTAATTCGACCGTTGTTGAAAATAT
TGCACCGCTTCGTGTGAATGATGTTGCAGATGTCTTGCATATTGATCAGC
TTGCCCGCGAAATTGCTAAGCAAGCGATGTTAAATGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy