Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR864 IGR869 IGR865 IGR870 IGR868 IGR867 IGR866 fabZ, - HD1188 pyrR, - HD1181 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 rfaE,rbsK, - HD1182 HD1183 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 pyrR, - HD1181 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 rfaE,rbsK, - HD1182 HD1183 dxr, - HD1186 ppG,relA, - HD1185 fabZ, - HD1188 pyrR, - HD1181 skp,omp26, - HD1190 lpxA, - HD1187 firA,lpxD, - HD1189 rfaE,rbsK, - HD1182 HD1183 dxr, - HD1186 ppG,relA, - HD1185
* Calculated from Protein Sequence

Gene ID: HD1185

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ppG  relA  

Definition:
GTP pyrophosphokinase (ppGpp synthetase I)/ATP:GTP 3'-pyrophosphotransferase

Gene Start:
962821

Gene Stop:
965028

Gene Length:
2208

Molecular Weight*:
84249

pI*:
6.80

Net Charge*:
-1.81

EC:
2.7.6.5  

Functional Class:
Regulatory functions  

Pathway: pathway table
Purine metabolism

Primary Evidence:
NULL

Secondary Evidence:
Metzger,S., Dror,I.B., Aizenman,E., Schreiber,G., Toone,M.,
Friesen,J.D., Cashel,M. and Glaser,G.
The nucleotide sequence and characterization of the relA gene of
Escherichia coli
J. Biol. Chem. 263 (30), 15699-15704 (1988)
MEDLINE: 89008481

Wendrich TM, Blaha G, Wilson DN, Marahiel MA, Nierhaus KH.
Dissection of the Mechanism for the Stringent Factor RelA.
Mol Cell. 2002 Oct;10(4):779-88.
PMID: 12419222

Masucci JP, Gallant J, Lindsley D, Atkinson J.
Influence of the relA gene on ribosome frameshifting.
Mol Genet Genomics. 2002 Sep;268(1):81-6.
PMID: 12242502



Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to ppGpp synthetase I from H. influenzae (1172903), E. coli (1710082), Vibrio cholerae (5738224), among others.

HD1185 is similar to spoT stringent response protein from M. pneumoniae (MP0441), and to ppGpp 3"-pyrophosphohydrolase from U. urealyticum (UU283) and M. genitalium (MG278). No similarities to C. trachomatis, C. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0317
COG name: Guanosine polyphosphate pyrophosphohydrolases/synthetases
Functional Class:  T,K
The phylogenetic pattern of COG0317 is -----qvcEbrHujgpo----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 188-353 are 71% similar to a (SYNTHETASE PROTEOME COMPLETE KINASE) protein domain (PD002902) which is seen in RELA_HAEIN.

Residues 354-395 are 69% similar to a (SYNTHETASE I KINASE GTP) protein domain (PD402602) which is seen in Q9CJX4_PASMU.

Residues 57-180 are 65% similar to a (SYNTHETASE COMPLETE PROTEOME) protein domain (PD002764) which is seen in RELA_HAEIN.

Residues 396-733 are 64% similar to a (SYNTHETASE COMPLETE PROTEOME KINASE) protein domain (PD003989) which is seen in RELA_HAEIN.

Residues 181-226 are 78% similar to a (PYROPHOSPHOKINASE PROTEOME COMPLETE GTP SYNTHETASE PPGPP) protein domain (PD253748) which is seen in Q9CJX4_PASMU.



Paralogs:  Local Blast Search

HD1185 is paralogously related to HD1924 (2e-91).


Pfam Summary:  Pfam Search
Residues 245 to 357 (E-value = 7e-72) place HD1185 in the RelA_SpoT family which is described as Region found in RelA / SpoT proteins (PF04607)
Residues 394 to 457 (E-value = 3e-30) place HD1185 in the TGS family which is described as TGS domain (PF02824)
Residues 659 to 733 (E-value = 2.5e-07) place HD1185 in the ACT family which is described as ACT domain (PF01842)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MVAIRRSHELDPSTFELASWSASLQMSPITFEELQIAWRYIHEKLDTDSY
HLMWDGVEMVELLHGLNMDDDSLVAALLFPLVKNNIVDLAQVKEEFSNQV
KNLVKGVIEMDNIRQLNASSRSDFQIDNIRRMLLAMVDDFRCVVIKLAER
IAYLREIHRYTEEDLVLAAKECSHIYAPLANRLGIGQLKWELEDYCFRVL
HPQSYRRIATQLGERRLERENYIANFVSQLTASLTEEVDTLEVYGRPKHI
YSIWKKMQKKNVQFEQLFDIRAVRVIVPNVQDCYSVLGIIHTQYKHLPEH
FDDYIAHPKPNGYQSIHTVVLGEGEQPIEVQIRTRKMHDEAELGIAAHWK
YKEGPTVSRSGYEEKIIWLRKLLAWQNDLAVSSDMMADMRSQIFDDRVYV
FTPRGEVIDLPKNSTPLDFAYAVHSEIGHRCIGAKIADRIVPFTYVLQMG
DQVEIITQKTPNPSRDWLSPQAGFVNTSKARAKIIAWFKKLDREKNIPLG
KEALEAEISRLGLSHKQIEQYALPRYNLKQFDDLYAAIGGGDIRLNQLSH
YLQSKLIKPTAEQEDEAVLKHVNKNAYNAQQQKGKNGQIIIDGVGNLMHN
LARCCQPIPGDDIVGYITQGRGISIHCANCEQLFELRSANPERIVSAQWD
SHFKAGFSLRIRIIANERNGLLRDVSAVMANEKVNVLTVASRQDIKRGLT
VMDIELEMSNVEMLAKILTRISQLESVIEAKRLAN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTGCAATACGTCGTTCACACGAGCTTGACCCTAGTACTTTTGAATT
AGCGAGTTGGAGCGCTTCGTTGCAGATGTCGCCGATTACCTTTGAAGAAT
TGCAAATAGCCTGGCGTTATATTCATGAAAAATTGGATACGGACAGTTAC
CATTTAATGTGGGACGGTGTTGAGATGGTAGAGCTGTTACATGGCTTGAA
TATGGACGATGATTCACTGGTTGCGGCTTTATTATTTCCACTTGTCAAAA
ACAATATTGTTGATTTGGCGCAAGTCAAAGAGGAATTCAGTAACCAAGTT
AAAAATTTGGTTAAAGGCGTGATTGAAATGGACAATATTCGCCAATTGAA
TGCGAGTAGCCGTTCTGATTTCCAGATTGATAACATTCGTCGAATGTTAT
TGGCAATGGTGGATGATTTCCGCTGTGTCGTGATTAAGCTAGCTGAACGT
ATTGCCTATTTACGAGAAATACACCGCTATACAGAAGAAGATTTAGTGTT
AGCTGCTAAAGAGTGTTCTCATATTTATGCACCCTTAGCAAACCGTCTAG
GCATAGGCCAATTAAAATGGGAATTAGAGGATTATTGTTTCCGGGTATTG
CATCCCCAATCTTATCGTAGGATTGCCACTCAATTAGGCGAACGTCGTTT
AGAACGAGAAAATTATATTGCAAATTTTGTTTCACAATTGACCGCTTCAT
TAACTGAAGAAGTGGATACATTAGAAGTGTATGGTCGTCCAAAACATATT
TATAGCATTTGGAAGAAAATGCAGAAGAAAAATGTGCAGTTCGAACAACT
ATTTGATATTCGCGCGGTACGGGTGATTGTACCAAACGTTCAAGATTGCT
ATAGCGTGCTAGGAATTATCCATACTCAGTATAAACATTTGCCAGAACAC
TTTGACGACTATATTGCGCATCCTAAACCGAACGGTTACCAATCTATTCA
TACCGTAGTATTAGGTGAAGGTGAACAGCCTATTGAAGTACAAATTCGTA
CGCGTAAAATGCATGATGAAGCTGAACTAGGCATAGCGGCACATTGGAAA
TACAAAGAAGGCCCGACAGTCAGTCGTTCGGGTTATGAAGAAAAAATTAT
TTGGCTACGTAAATTATTAGCGTGGCAAAATGATCTTGCGGTTTCAAGCG
ATATGATGGCGGATATGCGTTCGCAGATCTTTGATGATCGTGTATATGTG
TTTACACCGCGTGGTGAAGTGATTGATTTGCCGAAAAATTCAACACCACT
TGATTTTGCGTATGCAGTTCATAGTGAAATTGGGCATCGTTGTATAGGCG
CTAAAATTGCTGACAGGATCGTGCCGTTCACTTATGTATTGCAAATGGGC
GATCAAGTTGAAATTATTACTCAGAAAACCCCAAACCCAAGCCGTGATTG
GCTGAGCCCTCAAGCGGGTTTTGTGAATACCTCAAAAGCGCGCGCCAAAA
TTATTGCTTGGTTTAAAAAATTAGATCGAGAAAAAAATATTCCGCTCGGT
AAAGAAGCGCTTGAGGCTGAAATAAGCCGTTTAGGTCTTAGCCATAAGCA
GATCGAACAATATGCGTTGCCACGTTATAACTTAAAACAATTTGATGATT
TATATGCCGCCATTGGTGGTGGCGATATTCGCTTGAATCAGTTGAGTCAC
TACTTGCAAAGTAAATTAATCAAGCCAACGGCAGAGCAAGAAGACGAAGC
TGTATTAAAGCATGTGAATAAAAATGCCTATAATGCACAGCAACAAAAAG
GCAAAAACGGGCAAATTATCATTGATGGTGTGGGTAACTTAATGCATAAC
CTAGCGCGTTGTTGTCAGCCAATCCCGGGAGATGATATTGTCGGCTATAT
CACGCAAGGCCGTGGCATTTCCATTCATTGTGCTAATTGTGAACAACTAT
TTGAATTACGTAGCGCAAATCCAGAACGAATTGTTTCAGCACAATGGGAT
AGCCATTTTAAAGCCGGATTTAGTTTAAGGATTCGCATTATTGCGAATGA
GCGCAATGGCTTATTACGCGATGTAAGTGCTGTGATGGCAAATGAAAAAG
TTAATGTATTGACTGTCGCTAGCCGGCAAGATATTAAGCGGGGCTTAACT
GTGATGGATATTGAGCTTGAAATGTCTAATGTAGAAATGTTAGCTAAAAT
TTTAACGCGGATTAGTCAGTTAGAATCAGTGATTGAAGCAAAACGGCTAG
CAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy