Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR864 IGR860 IGR865 IGR862 IGR861 IGR867 IGR863 IGR866 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 pyrR,upp, - HD1178 fadD, - HD1176 dxr, - HD1186 ppG,relA, - HD1185 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 pyrR,upp, - HD1178 fadD, - HD1176 dxr, - HD1186 ppG,relA, - HD1185 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 pyrR,upp, - HD1178 fadD, - HD1176 dxr, - HD1186 ppG,relA, - HD1185 fadD, - HD1177 fadD, - HD1175 fadD, - HD1177 fadD, - HD1175
* Calculated from Protein Sequence

Gene ID: HD1182

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rfaE  rbsK  

Definition:
ADP-heptose synthase/possible ribokinase

Gene Start:
960902

Gene Stop:
959472

Gene Length:
1431

Molecular Weight*:
52022

pI*:
6.50

Net Charge*:
-3.98

EC:
2.7.-.-  2.7.1.15  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Pentose phosphate pathway

Secondary Evidence:
Valvano,M.A., Marolda,C.L., Bittner,M., Glaskin-Clay,M., Simon,T.L. and Klena,J.D.
The rfaE gene from Escherichia coli encodes a bifunctional protein
involved in the biosynthesis of the lipopolysaccharide core
precursor ADP-L-glycero-D-manno-heptose
J. Bacteriol. 182 (2), 488-497 (2000)
PMID: 10629197

Comment:
For other "rfa" genes, see HD0653 (rfaF) and HD1890 (rfaD).

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to ADP-heptose synthase from H. influenzae (6093960), E. coli (6093959), Salmonella enterica (5734094), among others. Less similar to RBSK_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0524
COG name: Sugar kinases, ribokinase family
Functional Class: G
The phylogenetic pattern of COG0524 is AMTKYqVCEBRHuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002173 (PfkB family of carbohydrate kinases) with a combined E-value of 1e-06.
    IPB002173A    50-65
    IPB002173B    258-272


ProDom Summary:  Protein Domain Search
Residues 111-255 are 77% similar to a (SYNTHASE COMPLETE PROTEOME ADP-HEPTOSE) protein domain (PD010962) which is seen in RFAE_HAEIN.

Residues 6-284 are 28% similar to a (BIFUNCTIONAL TRANSFERASE /TRANSFERASE) protein domain (PD211644) which is seen in Q9Z5B5_STRCO.

Residues 342-472 are 83% similar to a (TRANSFERASE CYTIDYLYLTRANSFERASE NUCLEOTIDYLTRANSFERASE) protein domain (PD001938) which is seen in RFAE_HAEIN.

Residues 249-313 are 49% similar to a (PROTEOME COMPLETE SYNTHASE ADP-HEPTOSE) protein domain (PD389317) which is seen in O66836_AQUAE.

Residues 13-110 are 71% similar to a (SYNTHASE ADP-HEPTOSE PROTEOME COMPLETE) protein domain (PD357877) which is seen in RFAE_HAEIN.

Residues 259-314 are 83% similar to a (SYNTHASE ADP-HEPTOSE PROTEOME COMPLETE) protein domain (PD013115) which is seen in RFAE_HAEIN.



Paralogs:  Local Blast Search
HD1182 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 308 (E-value = 5e-44) place HD1182 in the PfkB family which is described as pfkB family carbohydrate kinase (PF00294)
Residues 345 to 471 (E-value = 1.1e-24) place HD1182 in the CTP_transf_2 family which is described as Cytidylyltransferase (PF01467)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MMMQYSLKFNQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVKVKDMEER
AGGAANVAMNIASLNATVALHGLVGHDDAGCVLDMLLKNHHIQNHCITLD
SHPTITKLRILSRHQQLLRLDFEESFHNVESSPLLAKLQQQITGYGALIL
SDYGKGTLAAVQQMIQIARQAKVPVLIDPKGTDFERYRGATLLTPNMAEF
EAVVGACLNDNDIVSKGLKLINDLELSALLVTRSEKGMTLLRPNHPPFHL
PTQAKEVYDVTGAGDTVISILATAIADGRPYEEACYLANAAAGIVVGKLG
TSTVNATELENAIHHREETGFGIVTEERLKQFTKEAKNRGEKIVMTNGCF
DILHPGHVSYLENARKLGDRLIVAVNCDQSVKRLKGESRPINSLSARMAI
LAGLASVDWVIAFEEDTPQRLISEILPDVLVKGGDYKPEQIVGCQEVWAN
GGNVKALNFEDGCSTTDVIKKIQAIR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGATGCAATACTCCCTTAAATTTAATCAAGCAAAAGTATTAGTGCT
TGGTGATGTAATGTTAGATCGTTATTGGTTTGGCGCGACCAATCGTATTT
CACCTGAAGCGCCCGTTCCCGTGGTCAAAGTAAAAGATATGGAAGAACGC
GCAGGCGGTGCAGCAAATGTCGCAATGAATATTGCAAGTTTAAATGCAAC
GGTTGCTCTACACGGTTTAGTTGGCCACGATGACGCAGGCTGTGTATTGG
ATATGTTATTGAAAAACCATCATATCCAAAATCATTGTATAACACTCGAT
AGCCACCCGACTATCACTAAATTACGTATTCTTTCTCGCCATCAGCAATT
ATTACGCTTAGATTTTGAAGAAAGTTTTCATAACGTTGAGAGTTCGCCAC
TATTAGCAAAACTTCAGCAACAAATTACCGGTTATGGTGCACTTATCTTA
TCAGATTATGGCAAAGGCACTCTTGCTGCCGTTCAGCAAATGATCCAAAT
TGCACGACAAGCGAAAGTCCCTGTATTAATCGATCCTAAAGGCACTGACT
TTGAACGCTACCGTGGTGCGACACTATTAACACCTAATATGGCAGAATTT
GAAGCAGTAGTGGGGGCTTGTTTGAATGATAATGACATTGTTAGCAAAGG
ATTAAAGCTGATCAATGACCTTGAACTAAGTGCGTTATTAGTAACGCGTT
CTGAAAAAGGAATGACTTTATTACGCCCCAATCACCCCCCATTCCACCTG
CCAACACAAGCTAAAGAAGTCTATGATGTAACCGGTGCAGGAGATACCGT
AATCAGTATTTTAGCGACCGCTATCGCTGATGGCAGACCTTATGAAGAAG
CGTGTTATTTGGCTAATGCAGCAGCAGGTATTGTAGTAGGTAAATTAGGT
ACCTCTACCGTAAATGCGACAGAATTAGAAAATGCGATTCATCATCGAGA
AGAAACCGGATTTGGTATCGTCACCGAAGAACGATTAAAACAGTTTACTA
AAGAAGCCAAAAATCGTGGTGAAAAAATCGTCATGACAAATGGTTGTTTT
GATATTTTACACCCAGGCCACGTTTCTTATTTAGAAAATGCGCGTAAATT
AGGTGATCGTTTGATTGTTGCAGTTAACTGTGATCAATCAGTGAAACGCC
TGAAAGGTGAAAGCCGTCCAATCAATTCACTCAGTGCACGAATGGCAATC
TTAGCGGGCTTAGCTTCTGTCGATTGGGTCATTGCTTTTGAAGAAGATAC
GCCACAACGCTTAATCAGTGAAATATTACCCGATGTACTGGTAAAAGGTG
GCGACTATAAACCTGAACAGATTGTAGGATGTCAAGAGGTATGGGCAAAC
GGAGGCAATGTCAAGGCATTAAACTTTGAAGATGGTTGTTCCACTACCGA
CGTTATTAAGAAAATTCAAGCAATAAGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy