Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR859 IGR864 IGR860 IGR865 IGR862 IGR861 IGR863 IGR866 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 pyrR,upp, - HD1178 fadD, - HD1176 ppG,relA, - HD1185 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 pyrR,upp, - HD1178 fadD, - HD1176 ppG,relA, - HD1185 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 pyrR,upp, - HD1178 fadD, - HD1176 ppG,relA, - HD1185 fadD, - HD1177 fadD, - HD1175 fadD, - HD1177 fadD, - HD1175 rseC, - HD1174
* Calculated from Protein Sequence

Gene ID: HD1181

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pyrR  

Definition:
pyrimidine operon regulatory protein

Gene Start:
959459

Gene Stop:
958920

Gene Length:
540

Molecular Weight*:
20258

pI*:
6.50

Net Charge*:
-1.55

EC:
2.4.2.9  

Functional Class:
Regulatory functions; General regulatory  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Elagoz,A., Abdi,A., Hubert,J.C. and Kammerer,B.
Structure and organisation of the pyrimidine biosynthesis pathway
genes in Lactobacillus plantarum: a PCR strategy for sequencing
without cloning
Gene 182 (1-2), 37-43 (1996)
Medline: 97136688


Savacool HK, Switzer RL.
Characterization of the interaction of Bacillus subtilis PyrR with pyr mRNA by site-directed mutagenesis of the protein.
J Bacteriol. 2002 May;184(9):2521-8.
PMID: 11948166



Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to pyrimidine operon regulatory protein PyrR from Bacillus caldolyticus (730439), Deinococcus radiodurans (7473753), Lactobacillus plantarum (1514599), among others. Also a hit to a hypothetical protein (possible transcriptional regulator) from H. influenzae (1175249),

HD1181 is weakly similar to hypoxanthine-guanine phosphoribosyltransferase from U. urealyticum (UU104). No similarities to C. trachomatis, C. pneumoniae, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 4 clades of COG2065
COG name: Pyr operon attenuation protein/uracil phosphoribosyltransferase
Functional Class: F
The phylogenetic pattern of COG2065 is -------c-brh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 18-151 are 55% similar to a (TRANSFERASE PHOSPHORIBOSYLTRANSFERASE) protein domain (PD000249) which is seen in O52707_ENTFA.

Residues 81-173 are 74% similar to a (REGULATORY COMPLETE PROTEOME PYRIMIDINE) protein domain (PD010548) which is seen in Y459_HAEIN.

Residues 32-80 are 65% similar to a (COMPLETE PROTEOME TRANSFERASE PYRR) protein domain (PD008075) which is seen in Y459_HAEIN.



Paralogs:  Local Blast Search

HD1181 is paralogously related to HD1399 (4e-05).


Pfam Summary:  Pfam Search
Residues 2 to 151 (E-value = 2e-19) place HD1181 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:
pdb|1A4X|A Chain A, Pyrr, The Bacillus Subtilis Pyrimidine Bios... 164 7e-042

Gene Protein Sequence:
MEKIIIDTEQFQRTISRISHQIIEKHAILDNIILVGIKRRGAEIAEMLQK
RISELAQISLPLMALDITFYRDDLNLTSKDPVYTGVEHQLNIEGKTVILI
DDVLFTGRTIRAALDALLDFGRAKRIELVILVDRGHRELPIRADYVGKNI
PTALNEQVQVRTEHYDGVSQVALIHSTNG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAATTATTATTGATACCGAGCAATTTCAACGTACTATTTCACG
AATCTCTCATCAAATTATTGAGAAACACGCTATTCTTGATAATATAATCT
TAGTTGGCATTAAACGTCGTGGTGCTGAAATTGCAGAAATGTTGCAAAAA
AGAATTAGTGAACTTGCACAAATTAGTTTACCGCTAATGGCTCTTGATAT
TACCTTTTATCGAGATGATTTAAATTTAACGAGCAAAGATCCTGTTTATA
CTGGAGTAGAACATCAACTCAATATCGAAGGTAAAACGGTTATTTTAATT
GATGATGTCCTATTTACTGGACGAACTATTCGTGCGGCATTAGACGCACT
ACTTGATTTTGGACGAGCCAAGCGAATTGAATTGGTTATTTTAGTCGATC
GTGGCCATCGAGAATTACCTATTCGAGCAGATTATGTGGGCAAAAATATC
CCCACTGCGCTAAATGAACAAGTACAAGTTAGAACTGAACATTATGATGG
TGTAAGCCAAGTCGCTTTAATCCATTCCACTAATGGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy