Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR859 IGR864 IGR860 IGR865 IGR862 IGR861 IGR863 IGR858 IGR866 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 ppG,relA, - HD1185 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 ppG,relA, - HD1185 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 ppG,relA, - HD1185 fadD, - HD1177 fadD, - HD1175 fadD, - HD1177 fadD, - HD1175
* Calculated from Protein Sequence

Gene ID: HD1180

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
surA  

Definition:
stationary phase survival protein SurA

Gene Start:
958831

Gene Stop:
957878

Gene Length:
954

Molecular Weight*:
35110

pI*:
8.80

Net Charge*:
2.21

EC:
5.2.1.8  

Functional Class:
Other categories; Adaptations and atypical conditions  

Pathway: pathway table

Secondary Evidence:
Tormo,A., Almiron,M. and Kolter,R.
surA, an Escherichia coli gene essential for survival in stationary phase
J. Bacteriol. 172 (8), 4339-4347 (1990)
Medline: 90330537

Lazar,S.W. and Kolter,R.
SurA assists the folding of Escherichia coli outer membrane
proteins
J. Bacteriol. 178 (6), 1770-1773 (1996)
Medline: 96198184

Missiakas,D., Betton,J.M. and Raina,S.
New components of protein folding in extracytoplasmic compartments
of Escherichia coli SurA, FkpA and Skp/OmpH
Mol. Microbiol. 21 (4), 871-884 (1996)
Medline: 97032152


Comment:


Blast Summary:  PSI-Blast Search
Few significant hits using gapped BLAST to survival protein SurA precursor from H. influenzae (1174486), E. coli (2507231), Neisseria meningitidis (7225507), and to hypothetical proteins from E. coli (482052, 78604).

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0760
COG name: Parvulin-like peptidyl-prolyl isomerase
Functional Class: O
The phylogenetic pattern of COG0760 is ----yQVcEB-HUJ--ol--X
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 172-313 are 54% similar to a (ISOMERASE PROTEOME SURVIVAL HOMOLOG) protein domain (PD064420) which is seen in SURA_HAEIN.

Residues 27-155 are 52% similar to a (COMPLETE PROTEOME ISOMERASE CIS-TRANS) protein domain (PD016651) which is seen in SURA_HAEIN.

Residues 180-268 are 48% similar to a (ISOMERASE PEPTIDYL-PROLYL CIS-TRANS) protein domain (PD002510) which is seen in SURA_ECOLI.



Paralogs:  Local Blast Search
HD1180 is paralogously related to HD1737 (2e-10).


Pfam Summary:  Pfam Search
Residues 177 to 270 (E-value = 5.9e-35) place HD1180 in the Rotamase family which is described as PPIC-type PPIASE domain (PF00639)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKLNSAKSLLVALVTAVSLSQSAMAWEEHVVATVNNIPVMESQVQSLLGQ
QKNSKTDRKMAIEHIIDDILVQKTIADAGIQVDYKLVDKAIEDIAASNGI
TYGQLLDAIDNQGISLDQYRGQIAQQMAMEQVRHMSISQSIQLDPNEVQT
LAKKMLEEDKAKGKLKKSMGTQYRISHILIKTTPVLNDAKAKAKLMRIAA
DIKAGKTTFEQAAKANSIDYISAADGGDLGYNFLDIYDPTFAKIANKAKQ
NQISAPFKSQFGWHILKVTATQKADRTEDSYNQFAYELLANQQGQEIAKD
WVKILRSSADIQYVDKQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTAAACTCTGCAAAATCATTATTAGTTGCATTAGTGACCGCAGT
TAGCTTATCTCAATCAGCAATGGCTTGGGAAGAACATGTAGTAGCAACAG
TGAATAATATTCCCGTGATGGAAAGCCAAGTCCAAAGCTTACTTGGTCAG
CAAAAAAATTCAAAAACAGACCGCAAAATGGCGATTGAACATATTATTGA
TGATATCCTTGTTCAAAAAACAATCGCAGATGCGGGCATTCAAGTGGACT
ATAAATTAGTTGATAAAGCGATTGAAGATATCGCGGCTAGCAATGGCATT
ACTTATGGGCAACTACTTGATGCCATAGATAATCAAGGAATTTCTCTCGA
TCAATATCGTGGACAAATCGCTCAGCAAATGGCAATGGAACAAGTTCGCC
ATATGAGTATCAGTCAGTCGATTCAACTTGATCCAAATGAAGTTCAAACA
TTAGCAAAAAAAATGCTTGAAGAAGATAAAGCTAAAGGCAAATTAAAGAA
AAGCATGGGTACACAATATCGCATAAGTCATATTTTGATTAAAACGACCC
CCGTTTTAAATGATGCAAAAGCCAAAGCGAAATTAATGCGAATTGCTGCT
GATATTAAAGCCGGCAAAACAACATTTGAACAAGCCGCAAAAGCAAATTC
TATTGATTATATTTCAGCTGCTGATGGCGGTGATTTAGGTTATAATTTTT
TAGATATTTACGATCCTACATTTGCAAAAATCGCTAATAAAGCTAAACAA
AATCAAATTTCTGCGCCCTTTAAATCACAATTTGGTTGGCATATTCTAAA
AGTGACCGCTACCCAAAAAGCCGATCGTACAGAAGATTCATACAATCAAT
TTGCTTATGAGCTTCTTGCTAACCAACAAGGTCAAGAAATAGCTAAAGAT
TGGGTTAAAATATTGAGATCTAGCGCTGATATTCAATATGTTGATAAGCA
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy