Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR859 IGR864 IGR857 IGR860 IGR865 IGR862 IGR861 IGR863 IGR858 IGR856 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 pyrR, - HD1181 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 fadD, - HD1177 fadD, - HD1175 fadD, - HD1177 fadD, - HD1175
* Calculated from Protein Sequence

Gene ID: HD1179

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ksgA  

Definition:
dimethyladenosine transferase

Gene Start:
957813

Gene Stop:
956944

Gene Length:
870

Molecular Weight*:
33445

pI*:
8.80

Net Charge*:
5.99

EC:
2.1.1.-  

Functional Class:
Other categories; Drug and analog sensitivity  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
van Buul,C.P. and van Knippenberg,P.H.
Nucleotide sequence of the ksgA gene of Escherichia coli:
comparison of methyltransferases effecting dimethylation of
adenosine in ribosomal RNA
Gene 38 (1-3), 65-72 (1985)
Medline: 86056993

Blanchin-Roland,S., Blanquet,S., Schmitter,J.M. and Fayat,G.
The gene for Escherichia coli diadenosine tetraphosphatase is
located immediately clockwise to folA and forms an operon with ksgA
Mol. Gen. Genet. 205 (3), 515-522 (1986)
Medline: 87172305

Roa,B.B., Connolly,D.M. and Winkler,M.E.
Overlap between pdxA and ksgA in the complex pdxA-ksgA-apaG-apaH
operon of Escherichia coli K-12
J. Bacteriol. 171 (9), 4767-4777 (1989)
Medline: 89359108

van Gemen,B., Koets,H.J., Plooy,C.A., Bodlaender,J. and Van
Knippenberg,P.H.
Characterization of the ksgA gene of Escherichia coli determining
kasugamycin sensitivity
Biochimie 69 (8), 841-848 (1987)
Medline: 88107880


Comment:


Blast Summary:  PSI-Blast Search
Significant hits using gapped BLAST to from H. influenzae (1170712), E. coli (125699), Neisseria meningitidis (7225925), among others.

HD1179 is similar to dimethyladenosine transferase from C. pneumoniae (CPn1059), C. trachomatis (CT354), U. urealyticum (UU601), M. pneumoniae (MP0163), M. genitalium (MG463), and T. pallidum (TP0337).


COGS Summary:  COGS Search
BeTs to 17 clades of COG0030
COG name: Dimethyladenosine transferase (rRNA methylation)
Functional Class: J
The phylogenetic pattern of COG0030 is amtkyqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001737 (Ribosomal RNA adenine dimethylase) with a combined E-value of 3.9e-41.
    IPB001737A    29-74
    IPB001737B    117-130
    IPB001737C    183-204


ProDom Summary:  Protein Domain Search
Residues 119-177 are 94% similar to a (TRANSFERASE DIMETHYLADENOSINE COMPLETE) protein domain (PD000922) which is seen in KSGA_HAEIN.

Residues 183-271 are 44% similar to a (RESISTANCE TRANSFERASE METHYLTRANSFERASE RRNA PLASMID) protein domain (PD332330) which is seen in KSGA_BUCAI.

Residues 234-276 are 79% similar to a (DIMETHYLTRANSFERASE KASUGAMYCIN MRNA) protein domain (PD405615) which is seen in Q9CLL5_PASMU.

Residues 20-80 are 67% similar to a (TRANSFERASE RESISTANCE METHYLTRANSFERASE RRNA ADENINE) protein domain (PD000786) which is seen in Q9KUS2_VIBCH.

Residues 183-233 are 84% similar to a (TRANSFERASE DIMETHYLADENOSINE PROTEOME) protein domain (PD355268) which is seen in Q9CLL5_PASMU.



Paralogs:  Local Blast Search
HD1179 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 273 (E-value = 9.8e-97) place HD1179 in the RrnaAD family which is described as Ribosomal RNA adenine dimethylase (PF00398)

PDB Hit:
pdb|1YUB| Solution Structure Of An Rrna Methyltransferase (Er... 89 9e-019
pdb|1QAN|A Chain A, The Structure Of The Rrna Methyltransferase... 85 1e-017

Gene Protein Sequence:
MRTSNSKKHLGHTARKRFGQNFLSDMNVIHNIVAAINPRNEDFLLEIGPG
LGALTEPVAEQVEKLTVIELDRDLAERLRHHPFLHHKLTVIEQDALRFNF
RDYFDSLNLNHHQAIRIFGNLPYNISTPLMFHLFKFHDLIQDMHFMLQKE
VVKRLCAAPNSKAYGRLTIMAQYYCQVIPVLEVPPTAFKPAPKVDSAVVR
LMPYKTLPYPVKDVYWLNRVTTHAFNQRRKTLRNALSTLFTAQQLEMLGI
NLTDRAENLTISDYARLANWLCDNPPAIDTNQEILYDEL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTACATCAAACTCTAAAAAACATTTAGGTCATACTGCGCGTAAGCG
TTTTGGTCAAAATTTCTTATCTGATATGAACGTCATTCATAATATTGTGG
CAGCAATTAACCCAAGAAATGAAGATTTCTTACTTGAAATAGGGCCGGGT
TTAGGTGCTTTAACGGAACCGGTTGCGGAACAAGTTGAAAAATTAACTGT
GATCGAATTAGATCGTGATCTAGCAGAACGATTACGCCATCATCCATTTT
TACACCATAAGTTAACGGTCATTGAACAAGATGCATTGCGATTTAATTTT
CGCGATTATTTTGATAGCCTCAATTTAAACCATCATCAAGCAATACGGAT
ATTCGGTAACTTACCTTATAATATTTCTACACCATTAATGTTTCACTTAT
TCAAATTCCATGATTTGATTCAAGATATGCATTTCATGTTGCAAAAAGAA
GTGGTAAAACGCTTATGTGCTGCCCCCAATAGTAAAGCATATGGTCGATT
AACTATTATGGCACAATACTATTGCCAAGTTATCCCCGTACTTGAAGTAC
CGCCTACCGCCTTTAAACCTGCTCCGAAAGTTGATTCGGCAGTCGTACGT
TTAATGCCTTATAAAACATTACCATATCCAGTTAAAGATGTTTATTGGTT
AAATCGCGTAACTACACACGCTTTCAACCAACGCCGTAAAACATTACGTA
ATGCATTATCGACGCTATTTACTGCGCAACAATTAGAAATGCTTGGTATT
AACTTAACAGATCGGGCAGAAAATCTAACAATTTCTGATTATGCACGCTT
AGCAAACTGGCTATGTGATAATCCTCCAGCCATAGATACTAATCAAGAAA
TACTTTATGATGAGCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy