Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR859 IGR864 IGR857 IGR860 IGR865 IGR862 IGR861 IGR863 IGR858 IGR856 pyrR, - HD1181 HD1171 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 pyrR, - HD1181 HD1171 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 pyrR, - HD1181 HD1171 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 fadD, - HD1177 fadD, - HD1175 fadD, - HD1177 fadD, - HD1175
* Calculated from Protein Sequence

Gene ID: HD1178

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pyrR  upp  

Definition:
uracil phosphoribosyltransferase

Gene Start:
956252

Gene Stop:
956878

Gene Length:
627

Molecular Weight*:
22501

pI*:
5.90

Net Charge*:
-4.40

EC:
2.4.2.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Uracil phosphoribosyltransferase

Secondary Evidence:
Andersen,P.S., Smith,J.M. and Mygind,B.
Characterization of the upp gene encoding uracil
phosphoribosyltransferase of Escherichia coli K12
Eur. J. Biochem. 204 (1), 51-56 (1992)
MEDLINE: 92155236

Savacool HK, Switzer RL.
Characterization of the interaction of Bacillus subtilis PyrR with pyr mRNA by site-directed mutagenesis of the protein.
J Bacteriol. 2002 May;184(9):2521-8.
PMID: 11948166

Martinussen J, Schallert J, Andersen B, Hammer K.
The pyrimidine operon pyrRPB-carA from Lactococcus lactis.
J Bacteriol. 2001 May;183(9):2785-94.
PMID: 11292797

Ghim SY, Kim CC, Bonner ER, D'Elia JN, Grabner GK, Switzer RL.
The Enterococcus faecalis pyr operon is regulated by autogenous transcriptional attenuation at a single site in the 5' leader.
J Bacteriol. 1999 Feb;181(4):1324-9.
PMID: 9973361


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to uracil phosphoribosyltransferase from H. influenzae (1174881), E. coli (7427937), Neisseria meningitidis (7226005), among others.

HD1178 is similar to uracil phosphoribosyltransferase from U. urealyticum (UU116), M. genitalium (MG030), M. pneumoniae (MP0121), and T. pallidum (TP0448). No similarities to C. trachomatis or C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0035
COG name: Uracil phosphoribosyltransferase
Functional Class:  F
The phylogenetic pattern of COG0035 is --t-Yqvcebrh--gp-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 8-206 are 86% similar to a (URACIL PHOSPHORIBOSYLTRANSFERASE) protein domain (PD003612) which is seen in Q9CPL8_PASMU.



Paralogs:  Local Blast Search
HD1178 is paralogously related to HD1627 (4e-04).


Pfam Summary:  Pfam Search
Residues 34 to 179 (E-value = 7e-14) place HD1178 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:
pdb|1UPF|A Chain A, Structure Of The Uracil Phosphoribosyltrans... 105 4e-024
pdb|1BD3|A Chain A, Structure Of The Apo Uracil Phosphoribosylt... 105 4e-024

Gene Protein Sequence:
MKVVEVKHPLVKHKLGLMRSADINTKDFRALATEVGSLLTYEAATDLETE
LVEIDGWCGKVEVERIKGKKVTVVPILRAGLGMMDGVLEHIPSARISVVG
IYRDEETLEPVPYFTKLANDVEERLAIIVDPMLATGGSMIATIDLLKKSG
CKHIKVLVLVAAPEGINALQAAHPDIELFTASIDSHLNQHGYIVPGLGDA
GDKIFGTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTGTAGAAGTAAAACATCCATTAGTTAAACATAAACTAGGTTT
AATGCGCTCTGCTGACATCAATACCAAAGATTTTCGTGCATTAGCAACAG
AAGTGGGGAGTCTATTAACTTATGAAGCCGCCACGGATTTGGAAACAGAG
TTGGTTGAGATTGATGGCTGGTGCGGTAAAGTAGAAGTAGAACGCATTAA
AGGCAAGAAAGTGACCGTTGTGCCTATTTTACGAGCGGGACTGGGTATGA
TGGACGGTGTGCTTGAGCATATTCCTAGTGCACGTATTAGTGTGGTGGGG
ATTTATCGTGATGAAGAAACGTTAGAGCCTGTTCCTTATTTCACTAAATT
AGCGAATGATGTAGAAGAACGTTTAGCGATTATTGTTGATCCTATGTTAG
CAACCGGTGGTTCAATGATTGCTACGATAGACTTATTGAAAAAGTCTGGT
TGTAAGCATATTAAAGTATTGGTGTTGGTGGCGGCGCCAGAAGGCATTAA
CGCATTACAAGCTGCCCATCCAGATATTGAGCTATTTACTGCTTCGATAG
ACAGCCATTTAAATCAACATGGTTATATTGTGCCTGGGCTTGGTGATGCG
GGCGATAAAATTTTTGGTACAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy