Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR859 IGR864 IGR857 IGR860 IGR865 IGR862 IGR861 IGR863 IGR858 IGR856 pyrR, - HD1181 HD1171 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 pyrR, - HD1181 HD1171 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 pyrR, - HD1181 HD1171 ksgA, - HD1179 surA, - HD1180 rfaE,rbsK, - HD1182 HD1183 rseC, - HD1174 rpoE, - HD1172 rseA,mclA, - HD1173 pyrR,upp, - HD1178 fadD, - HD1176 fadD, - HD1177 fadD, - HD1175 fadD, - HD1177 fadD, - HD1175
* Calculated from Protein Sequence

Gene ID: HD1177

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fadD  

Definition:
long-chain-fatty-acid-CoA ligase fragment

Gene Start:
955892

Gene Stop:
956212

Gene Length:
321

Molecular Weight*:
12269

pI*:
9.20

Net Charge*:
2.19

EC:
6.2.1.3  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid metabolism

Secondary Evidence:
Weimar,J.D., DiRusso,C.C., Delio,R. and Black,P.N.
Functional role of fatty acyl-coenzyme A synthetase in the
transmembrane movement and activation of exogenous long-chain fatty acids. Amino acid residues within the ATP/AMP signature motif of Escherichia coli FadD are required for enzyme activity and fatty acid transport
J. Biol. Chem. 277 (33), 29369-29376 (2002)
MEDLINE: 22162442


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to long-chain-fatty-acid-CoA ligase from H. influenzae (1170729), E. coli (462484, 462484), Neisseria meningitidis (7226802), among others. HD1176 is 77% similar to residues 459-558 of LCFA_HAEIN, and 70% similar to residues 457-552 of LCFA_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0318
COG name: Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II
Functional Class:  I
The phylogenetic pattern of COG0318 is A-t-Y---EBRh------inx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-68 are 75% similar to a (LIGASE SYNTHETASE PHOSPHOPANTETHEINE) protein domain (PD000081) which is seen in LCFA_HAEIN.



Paralogs:  Local Blast Search
HD1177 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIIVSGFNVYPNEIEDVIAHNPKVNEVVAIGIPSKTSGEAIKIFVTKKDE
SLTREELRNYCRQYLTGYKIPREIEFRDELPKSNIGKILRRVLRDEEVIK
IKALER$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCATTGTTTCGGGTTTTAATGTGTATCCGAATGAAATTGAAGATGT
AATCGCACATAACCCAAAAGTGAATGAAGTGGTTGCAATTGGTATACCAA
GTAAGACCTCTGGTGAAGCGATTAAAATCTTTGTGACCAAAAAAGATGAA
AGTTTGACGCGTGAAGAATTGCGTAATTATTGTCGACAATATTTGACGGG
CTATAAAATTCCTAGAGAGATTGAATTTCGTGATGAACTGCCCAAAAGCA
ATATTGGGAAAATTTTGCGTCGCGTATTAAGAGATGAAGAAGTGATTAAA
ATAAAAGCACTTGAACGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy