Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR852 IGR859 IGR851 IGR857 IGR853 IGR854 IGR850 IGR858 IGR855 IGR856 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 rseC, - HD1174 ribE, - HD1165 rpoE, - HD1172 rseA,mclA, - HD1173 fadD, - HD1176 ribA, - HD1163 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 rseC, - HD1174 ribE, - HD1165 rpoE, - HD1172 rseA,mclA, - HD1173 fadD, - HD1176 ribA, - HD1163 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 HD1166 HD1166 rseC, - HD1174 ribE, - HD1165 rpoE, - HD1172 rseA,mclA, - HD1173 ribA, - HD1163 fadD, - HD1175 fadD, - HD1176 fadD, - HD1175
* Calculated from Protein Sequence

Gene ID: HD1170

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hel  lpp  

Definition:
lipoprotein E/outer membrane protein P4, OMP P4 lipoprotein

Gene Start:
950789

Gene Stop:
949959

Gene Length:
831

Molecular Weight*:
31526

pI*:
10.00

Net Charge*:
8.88

EC:
3.1.3.2  

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  

Pathway: pathway table
gamma-Hexachlorocyclohexane degradation
Riboflavin metabolism

Secondary Evidence:
Green,B.A., Farley,J.E., Quinn-Dey,T., Deich,R.A. and Zlotnick,G.W.
The e (P4) outer membrane protein of Haemophilus influenzae:
biologic activity of anti-e serum and cloning and sequencing of the structural gene
Infect. Immun. 59 (9), 3191-3198 (1991)
MEDLINE: 91348867



Comment:
0

Blast Summary:  PSI-Blast Search
Some significant hits using gapped BLAST to lipoprotein E precursor from H. influenzae (97171, 1170200), to phytase from Enterobacter cloacae (2943981), to acid phosphatase from Chryseobacterium meningosepticum (2059351), among others. HD1170 is 58% similar to residues 6-274 from HEL_HAEIN. and 52% similar to residues 7-270 from gb|AAC05186.1.

HD1170 is similar to Ureaplasma specific conserved hypothetical protein from U. urealyticum(UU526). No similarities to C. trachomatis, C. pneumoniae, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 34-247 are 64% similar to a (LIPOPROTEIN PRECURSOR COMPLETE PROTEOME) protein domain (PD277568) which is seen in Q9CLY5_PASMU.



Paralogs:  Local Blast Search


HD1170 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 246 (E-value = 2.5e-90) place HD1170 in the Acid_phosphat_B family which is described as HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKLFKLTALTLASAFVLSGCTYHHNHKHYTDQHNQAILQEQATLGLNWMQ
QSGEYQALTHQAFNMAKMAFDQAKAKKGKKKAVIVDLDETMLDNSAYAGW
QVKNHETFSDEIWTRWVNARQTQAIAGAVAFNNYVNSHKGTMFYVSNRKD
STDKASTIENMKQLGFKGVSENKIFLKTDKSNKTPRFTEIEKQGYDIVLY
IGDNLNDFGDATYKKSNEERRQFVQENSAKFGKTFIVLPNPTYGDWEAGL
DKNYYKGDAKSRLDIRRNAINAWDGK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTGTTTAAATTAACGGCATTAACGCTTGCTTCCGCATTTGTTTT
AAGCGGTTGTACTTATCATCATAATCATAAGCATTATACTGATCAACACA
ATCAAGCTATTTTACAAGAACAAGCAACATTAGGCTTAAACTGGATGCAA
CAGTCAGGTGAATATCAAGCGCTTACCCACCAAGCTTTCAATATGGCAAA
AATGGCATTTGATCAAGCAAAAGCTAAAAAAGGGAAGAAGAAAGCAGTCA
TCGTGGATTTAGATGAAACTATGCTTGATAACAGCGCTTACGCTGGTTGG
CAAGTAAAAAATCACGAAACATTTAGCGATGAAATTTGGACACGCTGGGT
AAATGCACGTCAAACACAAGCAATTGCAGGGGCTGTTGCATTTAATAACT
ATGTGAATAGCCACAAAGGTACAATGTTTTATGTATCGAACCGTAAAGAT
AGCACTGACAAAGCTAGCACGATTGAGAATATGAAGCAATTGGGCTTTAA
AGGTGTGAGTGAAAATAAAATATTTCTTAAAACGGATAAGTCGAATAAAA
CGCCTCGCTTTACTGAAATTGAAAAACAAGGTTACGATATTGTGCTTTAT
ATTGGCGATAACTTAAATGACTTTGGCGATGCTACTTATAAAAAATCAAA
CGAAGAACGCCGTCAGTTCGTGCAAGAAAATAGCGCGAAGTTTGGCAAAA
CCTTCATTGTATTACCAAATCCTACTTATGGTGACTGGGAAGCGGGTTTA
GATAAAAATTATTATAAAGGTGATGCAAAAAGCCGTTTAGATATCCGCCG
TAACGCAATTAATGCTTGGGATGGCAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy