Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR852 IGR848 IGR851 IGR857 IGR849 IGR853 IGR854 IGR850 IGR858 IGR855 IGR856 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 rseC, - HD1174 ribE, - HD1165 rpoE, - HD1172 rseA,mclA, - HD1173 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 rseC, - HD1174 ribE, - HD1165 rpoE, - HD1172 rseA,mclA, - HD1173 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 HD1166 HD1166 rseC, - HD1174 ribE, - HD1165 rpoE, - HD1172 rseA,mclA, - HD1173 ribD,ribG, - HD1161 ribA, - HD1163 ribC, - HD1162
* Calculated from Protein Sequence

Gene ID: HD1169

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pepB  

Definition:
peptidase B

Gene Start:
949852

Gene Stop:
948542

Gene Length:
1311

Molecular Weight*:
46735

pI*:
6.50

Net Charge*:
-3.39

EC:
3.4.11.1  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Mathew,Z., Knox,T.M. and Miller,C.G.
Salmonella enterica serovar typhimurium peptidase B is a leucyl
aminopeptidase with specificity for acidic amino acids
J. Bacteriol. 182 (12), 3383-3393 (2000)

Suzuki,H., Kim,E., Yamamoto,N., Hashimoto,W., Yamamoto,K. and
Kumagai,H.
Mapping, cloning, and DNA sequencing of pepB gene which encodes
peptidase B of Escherichia coli K-12
J. Ferment. Bioeng. 82, 392-397 (1996)

Comment:
For other "pep" genes, see HD1832 (pepD), HD0555 (pepA), HD0976 (pepN).

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to peptidase B and few hits to leucyl aminopeptidase protein sequences,e.g.residues 121-444 are 37% similar to leucyl aminopeptidase in Haemophilus influenzae
strain Rd KW20 (1168441|).

Residues 17-441 are 55% similar to peptidase B in Escherichia coli (2506092|).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0260
COG name: Leucyl aminopeptidase
Functional Class: E
The phylogenetic pattern of COG0260 is -----q-cEbrHujgp--inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000819 (Cytosol aminopeptidase) with a combined E-value of 2.3e-78.
    IPB000819A    107-116
    IPB000819B    144-182
    IPB000819C    194-209
    IPB000819D    251-293
    IPB000819E    301-316
    IPB000819F    338-385
    IPB000819G    390-404


ProDom Summary:  Protein Domain Search
Residues 4-397 are 59% similar to a (AMINOPEPTIDASE HYDROLASE LEUCYL LEUCINE) protein domain (PD002804) which is seen in Q9CM16_PASMU.



Paralogs:  Local Blast Search
HD1169 is paralogously related to HD0555 (2e-50).


Pfam Summary:  Pfam Search
Residues 104 to 425 (E-value = 1.2e-125) place HD1169 in the Peptidase_M17 family which is described as Cytosol aminopeptidase family, catalytic domain (PF00883)

PDB Hit:
pdb|1LAM| Leucine Aminopeptidase (Unligated) >gi|1127256|pdb... 148 1e-036
pdb|1BLL|E Chain E, Leucine Aminopeptidase (E.C.3.4.11.1) Compl... 148 1e-036

Gene Protein Sequence:
MTAMQINLSQQPAPSIWGEKAILSAHQNGFTIHLHADSLTTIQKAARKIK
NQNILNVSLVGEGWGLEECWAFQQGFVSVHHRGKIQYPPLAEQHAELEAR
LSCTDFARKIINEASNTLTPEQLAKQATEFITQQAIKYNLHNVVKFEIIQ
GQALDTANYAGIWAVGKGSANPPALLKLDFNPTGDENAPVLASLVGKGIT
FDSGGYSLKPSDSMSTMRTDMGGAALVTAALGLAIARGLTARVKLYLCCA
ENMVSSRAVKLGDLIHYRNGISVEVLNTDAEGRLVLADGLIDAAADQAQF
IIDAATLTGAAKVAVGNDYHTVLAMDVQLVNQLLTAADAENEPFWRLPFA
EFHRTQISSCFADIANISSVPVAAGASTACGFLSYFVPNYQQNWLHIDAS
ATFHRSASDLWAVGATGLGIRTLANLLLSKATAKNT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGCGATGCAAATTAACCTCTCCCAACAGCCTGCGCCATCAATATG
GGGAGAAAAAGCTATCCTTTCTGCCCATCAAAATGGCTTTACCATTCATC
TTCACGCTGATAGCCTAACCACTATTCAAAAAGCAGCACGTAAAATTAAA
AATCAAAATATCCTCAACGTATCACTAGTTGGCGAAGGGTGGGGCTTGGA
AGAGTGTTGGGCTTTTCAGCAAGGGTTTGTGAGTGTTCACCATCGTGGAA
AAATACAGTATCCACCACTTGCTGAACAGCACGCTGAATTAGAAGCACGG
TTAAGCTGTACTGATTTTGCGCGAAAAATTATCAACGAAGCATCAAATAC
ATTAACCCCTGAACAACTCGCTAAACAAGCGACTGAATTTATTACACAAC
AAGCGATCAAATATAACCTTCACAACGTTGTTAAATTTGAAATAATACAA
GGTCAGGCATTAGATACCGCAAATTATGCCGGCATTTGGGCGGTTGGCAA
AGGTTCAGCTAATCCGCCCGCTTTACTTAAATTAGATTTTAATCCAACCG
GTGATGAAAATGCGCCGGTATTAGCCTCTTTAGTTGGTAAAGGCATCACC
TTTGATAGCGGAGGTTATAGCCTTAAACCCAGTGATTCAATGAGTACCAT
GCGTACCGATATGGGCGGAGCAGCATTAGTTACTGCCGCATTAGGCCTAG
CAATTGCTCGCGGTTTAACCGCACGTGTTAAACTATATCTCTGTTGTGCT
GAAAATATGGTGAGCAGTCGCGCGGTTAAGCTCGGTGATCTTATTCATTA
CCGCAATGGTATTTCAGTTGAAGTATTAAATACGGATGCAGAAGGTAGAT
TAGTATTGGCTGATGGCCTGATTGATGCAGCTGCTGACCAAGCACAATTT
ATTATTGACGCTGCCACCTTAACCGGCGCAGCCAAAGTGGCTGTTGGCAA
TGATTACCATACTGTGTTAGCAATGGATGTTCAATTAGTCAACCAGTTAT
TAACTGCTGCTGACGCGGAAAATGAACCTTTTTGGCGATTGCCTTTTGCT
GAATTTCATAGAACACAAATTAGCTCTTGCTTTGCAGATATTGCTAACAT
TAGCTCTGTACCTGTCGCAGCAGGTGCTAGCACTGCTTGTGGCTTTTTAT
CGTATTTCGTGCCAAATTATCAGCAGAATTGGCTACACATTGACGCTTCC
GCCACTTTCCACCGTTCTGCAAGCGATCTATGGGCGGTGGGAGCAACAGG
ATTAGGCATTAGAACCTTAGCTAATTTATTACTAAGCAAAGCAACTGCCA
AAAACACGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy