Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR852 IGR848 IGR851 IGR849 IGR853 IGR854 IGR850 IGR855 IGR847 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 greB, - HD1167 HD1171 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 HD1166 HD1166 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpB, - HD1158 glpB, - HD1158
* Calculated from Protein Sequence

Gene ID: HD1165

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ribE  

Definition:
riboflavin synthase beta chain

Gene Start:
946470

Gene Stop:
946931

Gene Length:
462

Molecular Weight*:
16029

pI*:
5.80

Net Charge*:
-1.67

EC:
2.5.1.9  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Riboflavin metabolism

Secondary Evidence:
Illarionov B, Eisenreich W, Bacher A, Huber R, Steinbacher S, Fischer M.
Studies on the reaction mechanism of riboflavin synthase. X-ray crystal structure of a complex with 6-carboxyethyl-7-oxo-8-ribityllumazine.
Structure (Camb). 2002 Oct;10(10):1371.
PMID: 12377123

Vitreschak AG, Rodionov DA, Mironov AA, Gelfand MS.
Regulation of riboflavin biosynthesis and transport genes in bacteria by transcriptional and translational attenuation.
Nucleic Acids Res. 2002 Jul 15;30(14):3141-51.
PMID: 12136096

Fuller,T.E. and Mulks,M.H.
Characterization of Actinobacillus pleuropneumoniae riboflavin
biosynthesis genes
J. Bacteriol. 177 (24), 7265-7270 (1995)
MEDLINE: 96099314Ludwig,H.C., Lottspeich,F., Henschen,A.,

Ladenstein,R. and Bacher,A.
Heavy riboflavin synthase of Bacillus subtilis. Primary structure
of the beta subunit
J. Biol. Chem. 262 (3), 1016-1021 (1987)
MEDLINE: 87109205


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to riboflavin synthase beta chain from Actinobacillus pleuropneumoniae (1710405), Bacillus amyloliquefaciens (2497762), Bacillus subtilis (464616), among others. HD1165 is 89% similar to residues 39-153 from RISB_ACTPL.

HD1165 is similar to riboflavin synthase beta chain from C. trachomatis (CT732 ) and C. pneumoniae (CPn0873). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0054
COG name: Riboflavin synthase beta-chain
Functional Class:  H
The phylogenetic pattern of COG0054 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002180 (6,7-dimethyl-8-ribityllumazine synthase) with a combined E-value of 3.4e-65.
    IPB002180A    14-38
    IPB002180B    53-67
    IPB002180C    72-92
    IPB002180D    110-129
    IPB002180E    134-146


ProDom Summary:  Protein Domain Search
Residues 12-115 are 43% similar to a (SYNTHASE RIBOFLAVIN) protein domain (PD245101) which is seen in RISB_THEMA.

Residues 14-153 are 70% similar to a (SYNTHASE RIBOFLAVIN) protein domain (PD003664) which is seen in Q9KCL4_BACHD.

Residues 116-153 are 89% similar to a (SYNTHASE RIBOFLAVIN TRANSFERASE BETA) protein domain (PD324592) which is seen in RISB_ACTPL.



Paralogs:  Local Blast Search

HD1165 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 153 (E-value = 3.7e-94) place HD1165 in the DMRL_synthase family which is described as 6,7-dimethyl-8-ribityllumazine synthase (PF00885)

PDB Hit:
pdb|1RVV|1 Chain 1, SynthaseRIBOFLAVIN SYNTHASE COMPLEX OF BACI... 220 9e-059
pdb|1C2Y|A Chain A, Crystal Structures Of A Pentameric Fungal A... 157 5e-040
pdb|1C41|A Chain A, Crystal Structures Of A Pentameric Fungal A... 91 8e-020

Gene Protein Sequence:
MAKITGNLVATGLKFSIVTARFNDFINDKLLSGAVDTLVRHGAVESDIDT
VWVPGAFEIPLVAKKMAESGKYDAVICLGTVIRGSTTHYDYVCNEVAKGI
GAVALQTGVPIMFGVLTTESIEQAIERAGTKAGNKGAECALGAIEMVNVL
KAL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAAATTACCGGTAATTTAGTCGCTACAGGTTTAAAATTCAGCAT
TGTAACGGCACGTTTTAATGATTTTATTAATGATAAATTATTAAGTGGTG
CAGTAGATACACTCGTGCGCCACGGTGCGGTAGAATCGGATATTGACACT
GTTTGGGTGCCAGGTGCTTTTGAAATTCCACTTGTTGCCAAAAAAATGGC
AGAAAGCGGTAAATATGATGCAGTAATTTGCTTAGGTACGGTGATACGTG
GCTCAACCACGCATTATGATTATGTTTGTAATGAAGTAGCAAAAGGCATT
GGTGCAGTAGCGTTACAAACGGGTGTGCCAATTATGTTTGGTGTATTGAC
CACAGAAAGTATTGAACAAGCCATTGAGCGTGCGGGCACAAAAGCGGGCA
ATAAAGGCGCAGAATGTGCTTTAGGTGCAATCGAAATGGTGAATGTATTA
AAAGCACTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy