Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR852 IGR848 IGR851 IGR849 IGR853 IGR854 IGR850 IGR847 greB, - HD1167 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 greB, - HD1167 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 greB, - HD1167 hel,lpp, - HD1170 kpsF, - HD1168 pepB, - HD1169 HD1166 HD1166 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpB, - HD1158 glpB, - HD1158
* Calculated from Protein Sequence

Gene ID: HD1163

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ribA  

Definition:
3,4-dihydroxy-2-butanone 4-phosphate synthase (GTP cyclohydrase II)

Gene Start:
945155

Gene Stop:
946360

Gene Length:
1206

Molecular Weight*:
44158

pI*:
5.90

Net Charge*:
-6.90

EC:
3.5.4.25  5.4.99.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Riboflavin metabolism

Secondary Evidence:
Fuller,T.E. and Mulks,M.H.
Characterization of Actinobacillus pleuropneumoniae riboflavin
biosynthesis genes
J. Bacteriol. 177 (24), 7265-7270 (1995)
MEDLINE: 96099314


Comment:
Similar to GTP cyclohydrase II.

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to riboflavin biosynthesis protein RibA from Actinobacillus pleuropneumoniae (1730248), Bacillus amyloliquefaciens (1730249), and Bacillus subtilis (121062).

HD1163 is similar to GTP Cyclohydratase & DHBP Synthase from C. pneumoniae (CPn0872) and C. trachomatis (CT731). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.



COGS Summary:  COGS Search
BeTs to 6 clades of COG0108
COG name: 3,4-dihydroxy-2-butanone 4-phosphate synthase
Functional Class:  H
The phylogenetic pattern of COG0108 is Amt-yqvcebRhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000926 (GTP cyclohydrolase II) with a combined E-value of 4.2e-91.
    IPB000926A    215-242
    IPB000926B    252-274
    IPB000926C    294-328
    IPB000926D    329-357
    IPB000926E    385-395
***** IPB000422 (3,4-Dihydroxy-2-butanone 4-phosphate synthase) with a combined E-value of 8.1e-85.
    IPB000422A    10-57
    IPB000422B    82-93
    IPB000422C    97-108
    IPB000422D    120-170


ProDom Summary:  Protein Domain Search
Residues 202-349 are 89% similar to a (CYCLOHYDROLASE GTP II SYNTHASE) protein domain (PD003336) which is seen in GCH2_ACTPL.

Residues 350-398 are 91% similar to a (SYNTHASE RIBOFLAVIN BIOSYNTHESIS GTP) protein domain (PD403900) which is seen in GCH2_ACTPL.

Residues 204-374 are 27% similar to a (PLASMID TIORF58) protein domain (PD240881) which is seen in Q9R6K1_AGRTU.

Residues 22-201 are 85% similar to a (SYNTHASE RIBOFLAVIN BIOSYNTHESIS 4-PHOSPHATE) protein domain (PD003034) which is seen in GCH2_ACTPL.



Paralogs:  Local Blast Search

HD1163 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 201 (E-value = 1.5e-127) place HD1163 in the DHBP_synthase family which is described as 3,4-dihydroxy-2-butanone 4-phosphate synthase (PF00926)
Residues 204 to 374 (E-value = 1.8e-117) place HD1163 in the GTP_cyclohydro2 family which is described as GTP cyclohydrolase II (PF00925)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MFQFSTVDEALAAIAAGKIILVSDDENRENEGDFICALEFATPENINFMA
TYGKGLICTPISQALADKLSFHPMVTNNTDNHETAFTVSVDHINTGTGIS
AFERSLTALKMLEQNAQAADFRRPGHMFPLIAKEGGVLVRNGHTEATVDL
ARLAGLKPAGLCCEIMADDGTMMTMPQLQALAVKHNMPFITIAQLQEYRR
KYDSLVKLVSVVKMPTKYGEFMAHSFVEVISGKEHIALVKGEIGDGQAVL
ARIHSECLTGDAFGSQRCDCGQQFAAAMTQIEKEGRGVVLYLRQEGRGIG
LINKLRAYELQDKGMDTVEANLALGFKEDEREYYIGAQIFQALGVKSTRL
LTNNPAKISGLKQQGLNIIAREPIIVEPNQNDIDYLKVKQIKMGHMFNFE
Q$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTCAATTTTCAACAGTAGATGAAGCCTTAGCAGCAATTGCGGCGGG
CAAAATTATTTTAGTTTCTGATGATGAAAACCGTGAGAATGAAGGCGATT
TCATTTGTGCCTTAGAATTTGCTACACCAGAAAATATTAATTTTATGGCG
ACTTATGGCAAAGGTTTGATTTGTACGCCAATTTCACAAGCGCTAGCGGA
TAAATTAAGTTTTCATCCAATGGTAACAAATAATACGGATAATCATGAAA
CAGCTTTCACTGTATCCGTTGATCATATTAATACGGGCACCGGTATTTCA
GCCTTTGAACGCTCACTGACCGCATTAAAAATGCTTGAGCAAAATGCACA
AGCGGCTGATTTTCGTCGCCCAGGGCATATGTTCCCACTGATTGCTAAAG
AGGGGGGCGTGTTGGTACGTAATGGCCATACAGAAGCAACAGTCGATTTA
GCGCGCTTAGCAGGCTTAAAGCCTGCAGGCTTATGTTGTGAAATCATGGC
TGATGATGGCACTATGATGACTATGCCACAATTGCAAGCCTTAGCCGTTA
AACATAATATGCCTTTTATTACCATTGCGCAGCTACAAGAATATCGCCGT
AAATATGACAGCTTGGTTAAATTGGTTTCAGTTGTGAAAATGCCGACTAA
ATATGGTGAATTTATGGCGCATAGTTTTGTTGAAGTGATTTCAGGCAAAG
AACATATCGCTTTAGTAAAAGGCGAGATTGGTGATGGTCAAGCCGTATTA
GCACGTATCCATTCAGAATGCTTAACCGGCGATGCCTTTGGTTCTCAACG
TTGTGATTGTGGCCAACAATTTGCTGCAGCAATGACGCAAATTGAGAAAG
AAGGGCGAGGCGTTGTATTATATTTACGCCAAGAAGGTCGCGGTATTGGT
TTAATTAATAAATTACGTGCCTATGAACTACAAGATAAAGGTATGGATAC
GGTTGAGGCAAACCTTGCGCTAGGTTTTAAGGAAGATGAACGCGAATACT
ATATTGGTGCGCAGATTTTCCAAGCCTTAGGCGTGAAATCCACTCGCTTA
TTGACCAATAATCCAGCCAAAATTAGTGGCTTAAAACAACAAGGCTTAAA
TATTATCGCACGTGAGCCAATTATTGTTGAACCAAACCAAAATGATATTG
ATTACTTGAAAGTAAAACAGATCAAAATGGGGCATATGTTTAACTTTGAA
CAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy