Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR852 IGR848 IGR851 IGR849 IGR853 IGR850 IGR846 IGR847 greB, - HD1167 kpsF, - HD1168 pepB, - HD1169 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 greB, - HD1167 kpsF, - HD1168 pepB, - HD1169 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 greB, - HD1167 kpsF, - HD1168 pepB, - HD1169 HD1166 HD1166 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 glpB, - HD1158 glpB, - HD1158
* Calculated from Protein Sequence

Gene ID: HD1162

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ribC  

Definition:
riboflavin synthase alpha chain

Gene Start:
944452

Gene Stop:
945099

Gene Length:
648

Molecular Weight*:
23464

pI*:
8.10

Net Charge*:
2.34

EC:
2.5.1.9  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Riboflavin metabolism

Secondary Evidence:
Gerhardt S, Schott A, Kairies N, Cushman M, Illarionov B, Eisenreich W, Bacher A, Huber R, Steinbacher S, Fischer M.
Studies on the reaction mechanism of riboflavin synthase. X-ray crystal structure of a complex with 6-carboxyethyl-7-oxo-8-ribityllumazine.
Structure (Camb). 2002 Oct;10(10):1371.
PMID: 12377123


Vitreschak AG, Rodionov DA, Mironov AA, Gelfand MS.
Regulation of riboflavin biosynthesis and transport genes in bacteria by transcriptional and translational attenuation.
Nucleic Acids Res. 2002 Jul 15;30(14):3141-51.
PMID: 12136096

Fuller,T.E. and Mulks,M.H.
Characterization of Actinobacillus pleuropneumoniae riboflavin
biosynthesis genes
J. Bacteriol. 177 (24), 7265-7270 (1995)
MEDLINE: 96099314


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to riboflavin synthase alpha chain from Actinobacillus pleuropneumoniae (1710403), Bacillus subtilis (132633), and Bacillus amyloliquefaciens (2497759). HD1162 is 76% similar to residues 1-215 from RISA_ACTPL.

HD1162 is similar to riboflavin synthase from C. pneumoniae (CPn0532), and to riboflavin synthase alpha subunit from C. trachomatis (CT405). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.



COGS Summary:  COGS Search
BeTs to 9 clades of COG0307
COG name: Riboflavin synthase alpha chain
Functional Class:  H
The phylogenetic pattern of COG0307 is ----yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001783 (Riboflavin synthase alpha chain family lumazine binding domain) with a combined E-value of 5.4e-74.
    IPB001783A    1-12
    IPB001783B    38-50
    IPB001783C    65-108
    IPB001783D    135-147
    IPB001783E    155-183
    IPB001783B    135-147
    IPB001783D    38-50
    IPB001783E    58-86


ProDom Summary:  Protein Domain Search
Residues 1-72 are 80% similar to a (RIBOFLAVIN SYNTHASE ALPHA CHAIN) protein domain (PD329877) which is seen in RISA_ACTPL.

Residues 85-193 are 57% similar to a (RIBOFLAVIN SYNTHASE ALPHA CHAIN) protein domain (PD004110) which is seen in RISA_BACSU.



Paralogs:  Local Blast Search

HD1162 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 86 (E-value = 3e-36) place HD1162 in the Lum_binding family which is described as Lumazine binding domain (PF00677)
Residues 99 to 183 (E-value = 5.2e-40) place HD1162 in the Lum_binding family which is described as Lumazine binding domain (PF00677)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MFTGIIEEVGKVANIKQSGDFAVLTINACKVLKDVHLGDSIAVNGVCLTV
TSFNSTQFTADVMAETLRRTSLAQLHVASPVNLERAMPMNGRFGGHIVSG
HIDGTGEIIQITPANHSTWYRVKTSPKLMRYIVEKGSITIDGISLTVVDT
DQESFRVSIIPHTINQTNLATKTIGSIVNLENDIVGKYIERFVMKRTNTP
SKNAITAEFLEKVGF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTACAGGTATTATTGAAGAAGTGGGTAAAGTTGCGAATATCAAGCA
ATCAGGTGATTTTGCGGTACTGACCATTAATGCTTGCAAGGTACTCAAAG
ATGTACATTTAGGCGATAGCATAGCCGTGAATGGTGTCTGTTTAACCGTC
ACTTCTTTTAACTCAACACAATTTACAGCCGATGTGATGGCGGAAACTTT
ACGCCGTACATCGTTGGCACAGTTACACGTAGCTAGCCCGGTTAATCTAG
AACGTGCAATGCCAATGAATGGCCGTTTTGGTGGTCATATTGTATCTGGC
CATATTGATGGCACCGGTGAAATTATTCAAATTACTCCCGCAAATCACTC
TACTTGGTATCGGGTTAAAACTAGCCCTAAATTAATGCGTTATATTGTAG
AAAAAGGCTCAATTACCATTGATGGTATTAGTTTAACTGTAGTTGATACT
GATCAGGAGAGTTTTCGCGTGTCAATTATTCCGCATACGATTAATCAAAC
TAATTTAGCCACAAAAACGATAGGTAGTATAGTGAATTTAGAAAATGATA
TCGTTGGTAAATATATCGAACGGTTTGTAATGAAGCGGACAAATACACCA
TCTAAAAATGCAATTACTGCTGAGTTTTTAGAAAAAGTAGGTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy