Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR848 IGR851 IGR849 IGR850 IGR846 IGR845 IGR847 greB, - HD1167 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 greB, - HD1167 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 HD1166 greB, - HD1167 HD1166 ribE, - HD1165 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 glpB, - HD1158 glpB, - HD1158
* Calculated from Protein Sequence

Gene ID: HD1160

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glpC  

Definition:
anaerobic glycerol-3-phosphate dehydrogenase

Gene Start:
941700

Gene Stop:
942974

Gene Length:
1275

Molecular Weight*:
48059

pI*:
8.80

Net Charge*:
18.01

EC:
1.1.99.5  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Cole,S.T., Eiglmeier,K., Ahmed,S., Honore,N., Elmes,L.,
Anderson,W.F. and Weiner,J.H.
Nucleotide sequence and gene-polypeptide relationships of the
glpABC operon encoding the anaerobic sn-glycerol-3-phosphate
dehydrogenase of Escherichia coli K-12
J. Bacteriol. 170 (6), 2448-2456 (1988)
MEDLINE: 88227815

Ehrmann M, Boos W, Ormseth E, Schweizer H, Larson TJ.
Divergent transcription of the sn-glycerol-3-phosphate active transport (glpT) and anaerobic sn-glycerol-3-phosphate dehydrogenase (glpA glpC glpB) genes of Escherichia coli K-12.
J Bacteriol. 1987 Feb;169(2):526-32.
PMID: 3027032

Comment:
For other "glp" genes, see HD1146 (glpF), HD1147 (glpK), HD1148 (glpK), HD1150 (glpT), HD1152 (glpQ), HD1153 (glpQ), HD1154 (glpQ), HD1157 (glpA), HD1158 (glpB), HD1648 (glpR).

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to anaerobic glycerol-3-phosphate dehydrogenase, subunit C, from H. influenzae (1169947), E. coli (2506396), Methanococcus jannaschii (2494622), among others. HD1160 is 66% similar to residues 4-423 from GLPC_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0247
COG name: Fe-S oxidoreductases
Functional Class:  C
The phylogenetic pattern of COG0247 is AmT--Q-cEBrHUJ-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 26-102 are 92% similar to a (IRON-SULFUR PROTEOME COMPLETE REDUCTASE) protein domain (PD016240) which is seen in GLPC_HAEIN.

Residues 261-421 are 60% similar to a (COMPLETE PROTEOME DEHYDROGENASE) protein domain (PD033425) which is seen in Q9CL08_PASMU.

Residues 116-183 are 82% similar to a (DEHYDROGENASE SUBUNIT) protein domain (PD033428) which is seen in Q9CL08_PASMU.

Residues 187-250 are 82% similar to a (COMPLETE PROTEOME SUBUNIT IRON-SULFUR) protein domain (PD004891) which is seen in Q9CL08_PASMU.



Paralogs:  Local Blast Search


HD1160 is paralogously related to HD1221 (7e-10) and HD1220 (7e-05).


Pfam Summary:  Pfam Search
Residues 213 to 275 (E-value = 3.2e-09) place HD1160 in the CCG family which is described as Cysteine-rich domain (PF02754)
Residues 341 to 403 (E-value = 7.3e-15) place HD1160 in the CCG family which is described as Cysteine-rich domain (PF02754)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNIQQLIENAQRNTHSVVEHQHFDPSFESCLKCTACTAVCPVSRNNPFYP
GPKQSGPDGERLRLKSADFYDEALKYCTNCKRCEIACPSDVKIGDIIVRA
RNRYVERQNKPLVHKLRDAVLSNTDIMGRLNTPFAPLVNTITGLKVTRFL
LEKTLKVSKHRTLPKYAFGSFRNWYMKKEAKRQAQFKQHVAYYHGCYVNY
NNPQLGKEVIDVMNALDIGVLLLEKEKCCGLPLMVNGFPEHAKKQAKFNL
TQLEKMVKHNLDVVGTSSSCTANIKEEYSHVLGIPNATVSSHIDIITRYL
YKLQKQGKKLPLKPLRLRVAYHTACHVEKAGWAPYSLELLKQIPELEVVV
LPSQCCGIAGTYGFKAENYQTSQAIGRTLFEHINDGDFDYVISECETCKW
QVDMSSNVSCIHPITLLSMALARH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATTCAACAATTGATTGAAAATGCTCAACGAAATACTCATTCAGT
CGTTGAACATCAACATTTTGATCCGAGTTTTGAAAGCTGTTTAAAATGTA
CTGCGTGTACGGCAGTCTGTCCTGTTTCGCGCAATAATCCGTTTTATCCG
GGGCCAAAGCAGTCGGGGCCAGATGGTGAACGGCTACGGCTAAAAAGTGC
AGATTTTTATGATGAAGCATTGAAATATTGCACTAATTGCAAACGTTGTG
AAATTGCTTGTCCGTCTGATGTCAAAATTGGTGATATTATTGTTCGTGCT
AGAAATCGCTATGTTGAACGGCAAAATAAACCGCTTGTGCATAAATTGCG
TGATGCTGTGTTGAGTAATACCGATATTATGGGGCGTTTAAATACACCCT
TTGCACCTTTGGTCAATACTATTACAGGCTTAAAAGTAACGCGTTTCTTA
CTCGAAAAAACGTTAAAAGTGAGTAAGCACCGCACCTTGCCAAAATATGC
ATTTGGTTCATTTCGCAATTGGTATATGAAAAAAGAAGCTAAACGTCAGG
CACAATTTAAACAACATGTTGCCTATTATCACGGCTGTTATGTTAATTAT
AATAACCCTCAACTAGGGAAAGAAGTGATTGATGTTATGAACGCACTTGA
TATTGGCGTATTATTACTTGAGAAAGAAAAATGTTGTGGTTTACCGTTAA
TGGTAAATGGTTTTCCTGAACATGCTAAAAAACAGGCGAAATTTAATCTT
ACTCAATTAGAAAAAATGGTTAAGCATAATCTTGATGTTGTGGGTACTTC
TTCAAGCTGTACTGCAAATATTAAAGAGGAATATAGCCACGTGTTAGGCA
TTCCGAATGCAACCGTCAGTTCGCATATTGATATCATTACGCGTTATCTA
TATAAATTGCAAAAACAAGGTAAAAAACTACCGCTTAAACCTTTACGATT
ACGGGTTGCATATCATACGGCTTGCCACGTCGAAAAAGCAGGGTGGGCGC
CTTATAGCTTGGAATTATTAAAACAGATTCCTGAATTAGAAGTCGTTGTT
TTACCTTCACAATGTTGTGGTATTGCTGGCACTTATGGTTTTAAAGCGGA
AAATTATCAAACTTCGCAAGCCATTGGGCGCACGTTGTTTGAACATATCA
ATGATGGTGATTTTGATTATGTTATTTCAGAGTGTGAAACCTGTAAATGG
CAAGTGGATATGTCAAGTAATGTGAGTTGTATTCACCCAATCACTTTACT
TTCTATGGCATTAGCTAGACACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy