Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR848 IGR849 IGR846 IGR845 IGR847 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 ribC, - HD1162 ribD,ribG, - HD1161 ribA, - HD1163 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 glpB, - HD1158 glpB, - HD1158
* Calculated from Protein Sequence

Gene ID: HD1158

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glpB  

Definition:
anaerobic glycerol-3-phosphate dehydrogenase

Gene Start:
940555

Gene Stop:
941703

Gene Length:
1149

Molecular Weight*:
42576

pI*:
6.30

Net Charge*:
-5.70

EC:
1.1.99.5  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Cole ST, Eiglmeier K, Ahmed S, Honore N, Elmes L, Anderson WF, Weiner JH.
Nucleotide sequence and gene-polypeptide relationships of the glpABC operon encoding the anaerobic sn-glycerol-3-phosphate dehydrogenase of Escherichia coli K-12.
J Bacteriol. 1988 Jun;170(6):2448-56.
PMID: 3286606

Varga ME, Weiner JH.
Physiological role of GlpB of anaerobic glycerol-3-phosphate dehydrogenase of Escherichia coli.
Biochem Cell Biol. 1995 Mar-Apr;73(3-4):147-53.
PMID: 7576488

Comment:
For other "glp" genes, see HD1146 (glpF), HD1147 (glpK), HD1148 (glpK), HD1150 (glpT), HD1152 (glpQ), HD1153 (glpQ), HD1154 (glpQ), HD1157 (glpA), HD1160 (glpC), HD1648 (glpR).

Blast Summary:  PSI-Blast Search
Two strong hits in gapped BLAST to anaerobic glycerol-3-phosphate dehydrogenase, subunit B; e.g., residues 1-376 are 58% similar to residues 45-427 of GLPB_HAEIN [1169946], and residues 1-378 are 38% similar to residues 45-411 of GLPB_ECOLI [121404].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-378 are 59% similar to a (DEHYDROGENASE GLYCEROL-3-PHOSPHATE) protein domain (PD042531) which is seen in Q9CL07_PASMU.



Paralogs:  Local Blast Search


HD1158 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 378 (E-value = 4.7e-188) place HD1158 in the GlpB family which is described as Anaerobic glycerol-3-phosphate dehydrogenase subunit B (GlpB) (PF06982)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MDLLSCLPSGQKVHVFCEAFSELSQQAPEHPYCLLGQHQVVAKVQQFEQF
MQELGLVGSHKQNHLRVTPLGGLRHTWLSPKSVPVIAENEHFPYRQIAIL
GIEGYHDFQPQILVDNLKQNAAFSHCDFSIGYLNIPELDYLRQNAREFRS
VNIAQLLEHKLAFEDLVQEIKQAAGNAQAVFLLACFGLDDQRFFDSLKQA
TALALFELPTLPPSLIGIRQYRTLRDQFEKLGGLLLNGDRAVRAEFDGDR
VARIFTTLHQEESINAAHFVLASGSFFSNGLVAEFERVKEPIFDLDIIGN
KAFINSERVSWTDKRFAAAQPYQSAGVAINHHCQVYKNGHLIPNLYAIGN
VIGGFWGIEQGCASGVSVVTALTVAEWVGGTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTACTTTCATGTTTACCAAGCGGGCAAAAAGTACACGTTTTTTG
TGAGGCTTTTTCTGAGTTAAGCCAACAAGCACCCGAACATCCTTATTGTT
TATTAGGTCAACATCAAGTTGTAGCTAAAGTGCAACAATTTGAGCAATTT
ATGCAAGAATTAGGTTTGGTTGGCAGCCATAAACAAAACCATTTACGTGT
TACGCCCTTAGGTGGTTTACGCCATACTTGGTTATCGCCTAAAAGTGTGC
CTGTTATAGCAGAAAATGAACATTTCCCTTATCGTCAGATTGCTATTTTA
GGTATCGAAGGTTATCACGATTTCCAGCCACAAATATTAGTCGATAATTT
AAAGCAGAACGCAGCATTTTCGCATTGTGATTTCTCAATAGGATATTTGA
ATATTCCAGAATTAGACTATTTACGTCAAAATGCGCGAGAATTTCGGAGT
GTTAATATTGCTCAATTACTTGAGCATAAACTAGCGTTTGAAGATTTAGT
ACAAGAAATAAAACAGGCGGCGGGGAATGCACAAGCGGTATTTTTACTGG
CTTGTTTTGGTTTAGATGATCAAAGGTTTTTTGATAGTTTAAAACAAGCA
ACGGCGTTGGCTTTATTTGAATTACCCACTTTACCCCCTTCATTAATTGG
TATTCGCCAGTATCGAACATTACGTGATCAGTTTGAAAAATTAGGAGGAT
TGCTATTGAATGGCGACCGAGCAGTGAGGGCTGAGTTTGACGGTGATCGT
GTTGCGCGTATTTTCACGACATTACATCAAGAAGAATCGATTAATGCAGC
TCATTTTGTATTGGCTTCGGGGAGTTTCTTTAGTAATGGTTTAGTCGCTG
AATTTGAGCGGGTAAAGGAACCTATTTTTGACTTGGATATTATCGGTAAT
AAAGCCTTTATTAATTCGGAGAGAGTGTCTTGGACTGATAAACGTTTTGC
TGCAGCACAACCTTATCAATCTGCTGGGGTGGCGATTAATCATCATTGCC
AAGTTTATAAAAATGGGCATCTTATTCCAAATCTTTATGCAATAGGGAAT
GTCATTGGTGGCTTTTGGGGCATTGAACAAGGTTGTGCATCTGGTGTGTC
AGTTGTGACCGCATTAACAGTAGCAGAATGGGTGGGAGGTACAAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy