Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR848 IGR846 IGR845 IGR847 ribC, - HD1162 ribD,ribG, - HD1161 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 ribC, - HD1162 ribD,ribG, - HD1161 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 ribC, - HD1162 ribD,ribG, - HD1161 glpC, - HD1160 glpA, - HD1157 lspA2, - HD1156 glpB, - HD1158 glpB, - HD1158
* Calculated from Protein Sequence

Gene ID: HD1157

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glpA  

Definition:
anaerobic glycerol-3-phosphate dehydrogenase

Gene Start:
938751

Gene Stop:
940433

Gene Length:
1683

Molecular Weight*:
61359

pI*:
6.20

Net Charge*:
-5.39

EC:
1.1.99.5  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table
Glycerolipid metabolism

Primary Evidence:
Ward,C.K., Lumbley,S.R., Latimer,J.L., Cope,L.D. and Hansen,E.J.
Haemophilus ducreyi secretes a filamentous hemagglutinin-like
protein
J. Bacteriol. 180 (22), 6013-6022 (1998)
MEDLINE: 99030326


Secondary Evidence:
Iuchi S, Cole ST, Lin EC.
Multiple regulatory elements for the glpA operon encoding anaerobic glycerol-3-phosphate dehydrogenase and the glpD operon encoding aerobic glycerol-3-phosphate dehydrogenase in Escherichia coli: further characterization of respiratory control.
J Bacteriol. 1990 Jan;172(1):179-84.
PMID: 2403539

Cole ST, Eiglmeier K, Ahmed S, Honore N, Elmes L, Anderson WF, Weiner JH.
Nucleotide sequence and gene-polypeptide relationships of the glpABC operon encoding the anaerobic sn-glycerol-3-phosphate dehydrogenase of Escherichia coli K-12.
J Bacteriol. 1988 Jun;170(6):2448-56.
PMID: 3286606

Ehrmann M, Boos W, Ormseth E, Schweizer H, Larson TJ.
Divergent transcription of the sn-glycerol-3-phosphate active transport (glpT) and anaerobic sn-glycerol-3-phosphate dehydrogenase (glpA glpC glpB) genes
of Escherichia coli K-12.
J Bacteriol. 1987 Feb;169(2):526-32.
PMID: 3027032

Schryvers A, Weiner JH.
The anaerobic sn-glycerol-3-phosphate dehydrogenase: cloning and expression of the glpA gene of Escherichia coli and identification of the glpA products.
Can J Biochem. 1982 Mar;60(3):224-31.
PMID: 6282417

Comment:
For other "glp" genes, see HD1146 (glpF), HD1147 (glpK), HD1148 (glpK), HD1150 (glpT), HD1152 (glpQ), HD1153 (glpQ), HD1154 (glpQ), HD1158 (glpB), HD1160 (glpC), HD1648 (glpR).

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 3929024 and 7467548 in GenBank.

Numerous significant hits in gapped BLAST to anaerobic glycerol-3-phosphate dehydrogenase, subunit A; e.g., residues 1-560 are 81% similar to GLPA_HAEIN [1169945], and residues 18-544 are 68% similar to GLPA_ECOLI [2506446].

COGS Summary:  COGS Search
BeTs to 6 clades of COG0578
COG name: Anaerobic glycerol-3-phosphate dehydrogenase
Functional Class:  C
The phylogenetic pattern of COG0578 is ----y--cEbRh----o----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000447 (FAD-dependent glycerol-3-phosphate dehydrogenase) with a combined E-value of 7.6e-88.
    IPB000447A    19-71
    IPB000447B    77-104
    IPB000447C    204-226
    IPB000447D    257-279
    IPB000447E    316-327
    IPB000447F    341-377


ProDom Summary:  Protein Domain Search
Residues 52-233 are 85% similar to a (DEHYDROGENASE COMPLETE PROTEOME OXIDOREDUCTASE) protein domain (PD004630) which is seen in GLPA_HAEIN.

Residues 443-495 are 92% similar to a (SUBUNIT PROTEOME COMPLETE OXIDOREDUCTASE OXIDASE) protein domain (PD023752) which is seen in Q9CL06_PASMU.

Residues 1-51 are 52% similar to a (DEHYDROGENASE PROTEOME FAD SUBUNIT) protein domain (PD335224) which is seen in Q9CL06_PASMU.

Residues 236-398 are 91% similar to a (DEHYDROGENASE GLYCEROL-3-PHOSPHATE) protein domain (PD004694) which is seen in GLPA_HAEIN.

Residues 402-442 are 75% similar to a (DEHYDROGENASE PROTEOME FAD SUBUNIT) protein domain (PD238474) which is seen in GLPA_HAEIN.

Residues 487-544 are 75% similar to a (DEHYDROGENASE SUBUNIT) protein domain (PD190776) which is seen in GLPA_HAEIN.



Paralogs:  Local Blast Search

HD1157 is paralogously related to HD0796 (9e-04).


Pfam Summary:  Pfam Search
Residues 19 to 376 (E-value = 8.8e-124) place HD1157 in the DAO family which is described as FAD dependent oxidoreductase (PF01266)
Residues 441 to 497 (E-value = 1.8e-17) place HD1157 in the Fer2_BFD family which is described as BFD-like [2Fe-2S] binding domain (PF04324)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNVSPQIYRNVADFSPISTDVIIIGGGATGAGIARDCALRGLKCVLLERR
DIATGATGRNHGLLHSGARYAVNDRESAEECIKENLILKKIARHCIDDTK
GLFITLPEDDLNYQKTFLESCSASGIEAVAIDPELAKKLEPSVNPELVGA
VVVPDGSIDPFRLTASNMLDATENGAKIFTYCEVKGLIREGGRVIGVKVY
DHSNQCERQFFAQVVVNAGGIWGQGIAEYADLKIRMFPAKGALLVMGHRI
NNMVINRCRKPANADILVPGDTICIIGTTSDRIPYDQIDNMEVTPEEVDV
LFKEGEKLAPCLRHTRVLRAYAGVRPLVATDDDPSGRNVSRGIVLLDHAE
RDGLDGFITITGGKLMTYRLMAEWATDLVCKKLNKVSRCITAECALPGSS
ESRAETSQKIISLPNTIRHSAVYRHGSRATRLLENKRLDSTLICECEAVT
AGEVRYAIDELNVNNLVDLRRRTRVGMGTCQAELCACRAAGLMSRFNVST
PAESTTQLASFMEERWRGIQPIAWGDAMREAEFSSWIYYSLLGLNDVELS
HLGGVNSNEF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGTTTCGCCTCAAATATATCGAAATGTTGCTGATTTTTCACCAAT
TAGTACCGATGTTATTATTATTGGTGGTGGTGCTACTGGTGCGGGTATTG
CACGCGATTGTGCCTTGCGCGGTTTAAAATGTGTATTGCTTGAGCGCCGT
GATATTGCAACGGGTGCAACCGGTCGTAATCATGGTTTATTGCATAGTGG
AGCACGTTATGCTGTCAATGATCGTGAATCTGCAGAGGAATGTATAAAAG
AAAACCTTATTTTGAAAAAAATTGCTCGCCACTGTATTGATGATACTAAA
GGTCTGTTTATTACTTTACCTGAAGATGATCTTAATTATCAAAAAACTTT
TCTTGAATCTTGTTCTGCATCGGGCATTGAAGCGGTAGCAATTGACCCAG
AACTTGCTAAAAAACTAGAACCTTCCGTTAATCCTGAGCTAGTGGGCGCC
GTTGTTGTTCCCGATGGTTCAATCGATCCTTTCCGTTTAACCGCTTCCAA
TATGCTAGATGCCACAGAAAATGGTGCAAAAATTTTTACTTATTGTGAAG
TGAAAGGGCTTATCCGTGAAGGCGGTCGTGTCATTGGTGTAAAAGTTTAT
GATCATTCTAATCAGTGTGAGCGACAATTTTTTGCGCAAGTGGTTGTGAA
TGCCGGCGGAATTTGGGGGCAAGGCATTGCTGAGTATGCGGATCTGAAAA
TTAGAATGTTTCCAGCGAAAGGTGCGTTATTAGTTATGGGGCATCGTATT
AATAATATGGTGATTAATCGTTGTCGTAAGCCAGCTAATGCGGATATTTT
AGTGCCGGGTGATACGATTTGCATTATTGGCACGACTTCTGATCGTATTC
CTTATGATCAAATTGATAATATGGAAGTGACACCTGAAGAAGTGGATGTT
CTTTTTAAAGAAGGCGAGAAGTTAGCGCCTTGTTTACGCCATACGCGAGT
ATTACGTGCTTATGCCGGCGTAAGGCCATTAGTTGCAACAGATGATGATC
CTTCGGGGCGTAATGTTAGCCGTGGTATTGTGTTACTTGATCACGCTGAG
CGTGATGGCTTAGATGGCTTTATTACCATTACCGGTGGCAAATTAATGAC
CTATCGTTTAATGGCTGAGTGGGCGACGGATCTTGTTTGCAAAAAATTAA
ATAAAGTCAGCCGCTGTATTACTGCAGAATGCGCTTTGCCAGGATCAAGT
GAAAGCCGGGCAGAAACCAGCCAAAAGATTATATCTTTGCCCAATACGAT
TCGTCATTCTGCCGTTTATCGACACGGATCACGTGCAACACGTTTACTTG
AAAATAAACGGTTAGATAGCACGCTTATTTGTGAATGTGAGGCAGTAACT
GCAGGTGAAGTGCGTTATGCCATAGATGAATTGAATGTAAATAATTTAGT
TGATTTACGTCGTCGTACTCGAGTTGGAATGGGGACTTGTCAAGCAGAAC
TGTGCGCTTGTCGTGCTGCGGGTTTAATGAGTCGTTTTAATGTCTCGACA
CCGGCAGAATCAACCACTCAATTGGCTTCCTTTATGGAAGAACGTTGGCG
TGGTATTCAACCAATAGCGTGGGGCGATGCGATGCGTGAAGCAGAATTTT
CTAGTTGGATCTATTATAGTTTATTAGGGTTGAATGATGTTGAATTAAGC
CATCTAGGGGGAGTGAACAGCAATGAATTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy