Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR839 IGR842 IGR844 IGR841 IGR840 IGR837 IGR838 IGR843 HD1151 glpQ, - HD1152 glpQ, - HD1153 hpd,glpQ, - HD1154 glpT, - HD1150 lon, - HD1149 glpK, - HD1148 lspB, - HD1155 lspA2, - HD1156 HD1151 glpQ, - HD1152 glpQ, - HD1153 hpd,glpQ, - HD1154 glpT, - HD1150 lon, - HD1149 glpK, - HD1148 lspB, - HD1155 lspA2, - HD1156 glpQ, - HD1152 hpd,glpQ, - HD1154 glpT, - HD1150 lon, - HD1149 glpQ, - HD1153 HD1151 glpK, - HD1148 lspB, - HD1155 lspA2, - HD1156
* Calculated from Protein Sequence

Gene ID: HD1152

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glpQ  

Definition:
glycerophosphoryl diester phosphodiesterase

Gene Start:
920985

Gene Stop:
920827

Gene Length:
159

Molecular Weight*:
5962

pI*:
5.50

Net Charge*:
-1.54

EC:
3.1.4.46  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Phospholipid degradation

Secondary Evidence:
Janson,H., Heden,L.O., Grubb,A., Ruan,M.R. and Forsgren,A.
Protein D, an immunoglobulin D-binding protein of Haemophilus
influenzae: cloning, nucleotide sequence, and expression in
Escherichia coli
Infect. Immun. 59 (1), 119-125 (1991)
MEDLINE: 91099948

Janson,H., Ruan,M. and Forsgren,A.
Limited diversity of the protein D gene (hpd) among encapsulated
and nonencapsulated Haemophilus influenzae strains
Infect. Immun. 61 (11), 4546-4552 (1993)
MEDLINE: 94011360

Song,X.M., Forsgren,A. and Janson,H.
The gene encoding protein D (hpd) is highly conserved among
Haemophilus influenzae type b and nontypeable strains
Infect. Immun. 63 (2), 696-699 (1995)
MEDLINE: 95122210

Janson,H., Heden,L.O. and Forsgren,A.
Protein D, the immunoglobulin D-binding protein of Haemophilus
influenzae, is a lipoprotein
Infect. Immun. 60 (4), 1336-1342 (1992)
MEDLINE: 92192801


Comment:
For other "glp" genes, see HD1146 (glpF), HD1147 (glpK), HD1148 (glpK), HD1150 (glpT), HD1153 (glpQ), HD1154 (glpQ), HD1157 (glpA), HD1158 (glpB), HD1160 (glpC), HD1648 (glpR).

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to a portion of glycerophosphoryl diester phosphodiesterase precursor (Protein D) proteins; e.g., residues 1-49 are 85% similar to residues 313-361 of GLPQ_HAEIN [1169954], residues 3-48 are 63% similar residues 310-355 of GLPQ_ECOLI [121418].

COGS Summary:  COGS Search
BeTs to 3 clades of COG0584
COG name: Glycerophosphoryl diester phosphodiesterase
Functional Class:  C
The phylogenetic pattern of COG0584 is ----Y-v-EBRh--GP-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-52 are 80% similar to a (PHOSPHODIESTERASE GLYCEROPHOSPHODIESTER) protein domain (PD016854) which is seen in Q9CL04_PASMU.



Paralogs:  Local Blast Search

HD1152 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MELHPYTVRKDALPDFFSDVNQMYDVLLNKSGATGIFTDFPDTGVQFLKM
HK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACTTCATCCATACACTGTCCGGAAAGATGCATTACCTGATTTCTT
TAGTGATGTGAATCAAATGTATGATGTGTTATTAAATAAATCTGGTGCAA
CGGGTATTTTTACTGACTTTCCTGATACGGGGGTGCAGTTTTTAAAAATG
CATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy