Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR835 IGR839 IGR842 IGR833 IGR841 IGR840 IGR836 IGR837 IGR838 IGR843 IGR834 HD1151 glpQ, - HD1152 glpQ, - HD1153 hpd,glpQ, - HD1154 tlyC, - HD1145 glpT, - HD1150 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 lspB, - HD1155 HD1151 glpQ, - HD1152 glpQ, - HD1153 hpd,glpQ, - HD1154 tlyC, - HD1145 glpT, - HD1150 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 lspB, - HD1155 glpQ, - HD1152 hpd,glpQ, - HD1154 glpT, - HD1150 cutE, - HD1144 lon, - HD1149 glpQ, - HD1153 tlyC, - HD1145 HD1151 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 lspB, - HD1155
* Calculated from Protein Sequence

Gene ID: HD1149

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lon  

Definition:
ATP-dependent proteinase

Gene Start:
918980

Gene Stop:
916572

Gene Length:
2409

Molecular Weight*:
89115

pI*:
9.40

Net Charge*:
10.56

EC:
3.4.21.53  

Functional Class:
Regulatory functions  
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Thomas,C.D., Modha,J., Razzaq,T.M., Cullis,P.M. and Rivett,A.J.
Controlled high-level expression of the lon gene of Escherichia
coli allows overproduction of Lon protease
Gene 136 (1-2), 237-242 (1993)
Medline: 94124005

Amerik,A.Iu, Chistiakov,L.G., Ostroumova,N.I., Gurevich,A.I. and
Antonov,V.K.
Cloning, expression and structure of the functionally active
shortened lon gene in Escherichia coli
Bioorg. Khim. 14 (3), 408-411 (1988)
Medline: 88251494

Chin,D.T., Goff,S.A., Webster,T., Smith,T. and Goldberg,A.L.
Sequence of the lon gene in Escherichia coli. A heat-shock gene
which encodes the ATP-dependent protease La
J. Biol. Chem. 263 (24), 11718-11728 (1988)
Medline: 88298842



Comment:
This protein degrades short-lived regulatory and abnormal proteins in the presence of ATP.It degrades the regulatory proteins RCSA and SULA.It hydrolyzes two ATPs for each peptide bond cleaved in the protein substrate.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ATP-dependent protease LA protein sequences,e.g.residues 1-787 are 70% similar to ATP-dependent protease LA in Haemophilus influenzae strain Rd KW20 (1170813|).

Residues 1-786 are 67% similar to ATP-dependent protease LA protein in Escherichia coli K12 (547866|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0466
COG name: ATP-dependent Lon protease, bacterial type
Functional Class: O
The phylogenetic pattern of COG0466 is ----yqv-eb-hujgpOlinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003111 (ATP-dependent protease La (LON) domain) with a combined E-value of 5.3e-268.
    IPB003111A    209-243
    IPB003111B    276-305
    IPB003111C    314-359
    IPB003111D    388-426
    IPB003111E    427-475
    IPB003111F    525-558
    IPB003111G    598-616
    IPB003111H    622-648
    IPB003111I    666-685
    IPB003111J    686-732
***** IPB001984 (ATP-dependent serine proteases, Lon family) with a combined E-value of 1.9e-161.
    IPB001984A    23-32
    IPB001984B    161-194
    IPB001984C    351-387
    IPB001984D    435-475
    IPB001984E    533-556
    IPB001984F    598-616
    IPB001984G    622-648
    IPB001984H    666-692


ProDom Summary:  Protein Domain Search
Residues 576-635 are 85% similar to a (PROTEASE HYDROLASE ATP-BINDING SERINE) protein domain (PD001904) which is seen in LON_HAEIN.

Residues 137-281 are 51% similar to a (PROTEASE ATP-BINDING HYDROLASE SERINE) protein domain (PD002364) which is seen in LON_ERWAM.

Residues 636-713 are 91% similar to a (PROTEASE HYDROLASE ATP-BINDING SERINE) protein domain (PD001169) which is seen in LON_HAEIN.

Residues 630-713 are 58% similar to a (PROTEASE OF SIMILAR ATP-DEPENDENT) protein domain (PD020627) which is seen in Q9X1W8_THEMA.

Residues 10-133 are 58% similar to a (PROTEASE ATP-DEPENDENT LA ATP-BINDING HYDROLASE SERINE) protein domain (PD003709) which is seen in Q9CJM1_PASMU.

Residues 709-772 are 85% similar to a (PROTEASE ATP-BINDING SERINE HYDROLASE) protein domain (PD273602) which is seen in Q9CJM1_PASMU.

Residues 7-102 are 58% similar to a (PROTEOME COMPLETE PROTEASE ATP-BINDING) protein domain (PD111918) which is seen in LON_RHIME.

Residues 714-774 are 72% similar to a (PROTEASE ATP-DEPENDENT LA ATP-BINDING) protein domain (PD231765) which is seen in LON_VIBPA.

Residues 276-339 are 40% similar to a (PROTEASE ATP-BINDING LA ATP-DEPENDENT) protein domain (PD036883) which is seen in Q9DBN5_MOUSE.

Residues 686-752 are 70% similar to a (PROTEASE SERINE ATP-BINDING HYDROLASE ATP-DEPENDENT) protein domain (PD369339) which is seen in Q9PE39_XYLFA.

Residues 479-558 are 81% similar to a (PROTEASE ATP-BINDING HYDROLASE SERINE ATP-DEPENDENT) protein domain (PD002150) which is seen in Q9CJM1_PASMU.

Residues 303-550 are 69% similar to a (ATP-BINDING PROTEASE SUBUNIT PROTEOME COMPLETE) protein domain (PD000092) which is seen in LON_CAUCR.



Paralogs:  Local Blast Search
HD1149 is paralogously related to HD1500 (8e-07), HD1121 (4e-06), HD0179 (5e-05) and HD0565 (3e-04).


Pfam Summary:  Pfam Search
Residues 10 to 203 (E-value = 6.1e-26) place HD1149 in the LON family which is described as ATP-dependent protease La (LON) domain (PF02190)
Residues 353 to 547 (E-value = 4.3e-43) place HD1149 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 571 to 775 (E-value = 6.1e-149) place HD1149 in the Lon_C family which is described as Lon protease (S16) C-terminal proteolytic domain (PF05362)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAQRTKKSIALPLLPLRDVVVFPYMVMPLFVGREKSIQALHLAMDSNKQL
FLVTQQDPNKEDPSTDDVHHVGIIANIIQMLNLPDGTVKVLVEGQQRAKI
EQIHDNENGLWAVVQPLLSKTTKNNEELTAIAKLTTNEFENYVKNNKKIP
AEILPKLQKISSAERLADTISSNLIAPVKSKQAWLEETNLITRFEALLIA
MATEIDSLETENRIRNRVKQQMEKNQRDYYLNEQIKAIQKELNDGEDAEQ
SELDKLKDKIDATKLPVTVKEKLDSEFKKLKAMPQSSSEATVVRSYIDWV
LQIPWHKKSAVKKDLPQAQAVLDKDHYGLERVKERIVEYLAVQSRLNKLK
GPILCLVGPPGVGKTSLGKSIANATGRKYVRMALGGVRDEAEIRGHRRTY
IGSMPGQLMMKMAKVGVKNPLFLLDEIDKMAQDMRGDPASALLEVLDPEQ
NNTFNDHYLEVDYDLSDVMFVATSNSMNIPPALLDRMEVIRLSGYTEDEK
MHIAQEHLIAKQQENNGLKASELQIKESAILSIIRYYTREAGVRALEREI
AKICRKAVKALILDNKTKKITVTDKNIQDYLGVKRFDYGKMDTQNRVGEV
TGLAWTEVGGDLLTIETASVAGKGKFSYTGSLGDVMKESIQAAMMVVRAR
AKKLGIAENFHEKRDIHIHVPDGATPKDGPSAGIAMCTALISSLTGNPVR
ATVAMTGEISLRGKVLPIGGLKEKLLAAHRGGITTVIIPKDNEKDLEEIP
ANAKNSLMIHAVETIDEVLAIALENPPAGIEIMPAKSAGIKVRKTRSKTA
IQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTCAAAGAACTAAAAAATCTATTGCATTACCGCTCTTGCCGCTACG
TGATGTAGTGGTGTTTCCTTATATGGTAATGCCTCTATTTGTAGGCCGTG
AAAAATCAATCCAAGCACTGCATCTAGCAATGGATTCAAATAAGCAACTC
TTTCTAGTGACTCAGCAAGATCCTAATAAGGAAGATCCATCTACTGATGA
TGTTCACCACGTTGGTATTATTGCGAATATTATTCAAATGCTAAACTTGC
CTGATGGGACGGTTAAGGTGCTAGTGGAAGGGCAACAACGTGCCAAAATT
GAGCAAATTCACGATAATGAAAATGGTTTATGGGCGGTGGTGCAACCATT
ATTGTCTAAAACCACTAAAAATAATGAAGAATTAACCGCTATCGCTAAAC
TTACGACCAATGAGTTTGAAAACTACGTTAAAAATAATAAGAAAATTCCT
GCTGAAATTTTACCAAAATTACAAAAAATTTCTTCCGCAGAACGCTTAGC
GGATACTATTTCGTCAAATTTGATCGCTCCAGTAAAAAGTAAACAAGCGT
GGTTAGAAGAAACTAATTTAATTACTCGTTTTGAAGCATTATTAATTGCA
ATGGCAACGGAAATAGATTCGCTTGAAACGGAAAATCGGATTCGTAATCG
CGTCAAGCAGCAAATGGAGAAAAACCAACGTGATTATTATTTGAATGAGC
AAATTAAAGCGATTCAAAAAGAATTAAATGATGGTGAAGATGCGGAGCAA
AGTGAATTAGATAAACTTAAAGATAAAATTGATGCCACTAAATTACCTGT
TACAGTAAAAGAAAAATTAGATTCAGAATTCAAAAAATTAAAAGCGATGC
CACAAAGCTCTTCTGAAGCGACGGTAGTAAGAAGTTATATTGATTGGGTT
TTACAAATTCCTTGGCATAAAAAGTCGGCAGTTAAGAAAGATTTACCACA
AGCGCAAGCGGTCTTAGATAAAGATCACTATGGTTTAGAGCGTGTTAAAG
AACGTATTGTTGAATATTTGGCGGTGCAGAGCCGTTTAAATAAATTGAAA
GGGCCAATTTTATGCTTAGTCGGTCCACCTGGGGTGGGTAAAACATCTTT
AGGTAAATCAATTGCAAATGCAACAGGGCGTAAATATGTACGTATGGCAT
TAGGTGGTGTTCGTGATGAAGCAGAAATCCGTGGTCATCGCCGGACTTAT
ATTGGTTCTATGCCCGGTCAGTTGATGATGAAAATGGCAAAAGTGGGGGT
TAAAAACCCGCTATTCTTGCTCGATGAGATCGATAAAATGGCGCAAGATA
TGCGTGGCGATCCTGCTTCTGCCTTACTTGAAGTATTAGATCCGGAGCAA
AATAATACTTTTAATGATCATTATCTCGAAGTTGATTATGATTTATCTGA
TGTTATGTTTGTGGCAACGTCAAATTCAATGAATATTCCACCAGCATTAT
TGGATCGGATGGAGGTTATTCGTCTTTCTGGCTATACTGAAGATGAAAAA
ATGCATATTGCCCAAGAACATTTAATCGCGAAACAACAAGAAAATAACGG
GCTTAAAGCGAGTGAATTACAGATTAAAGAAAGTGCTATTTTAAGTATTA
TCCGTTATTACACGCGTGAAGCTGGTGTTCGTGCTTTAGAGCGTGAAATT
GCTAAAATTTGTCGTAAAGCCGTGAAAGCATTAATCTTAGATAATAAGAC
TAAAAAAATTACCGTTACTGATAAGAACATTCAAGACTATTTGGGCGTAA
AACGTTTTGACTACGGTAAAATGGATACTCAAAATCGTGTTGGTGAAGTC
ACGGGATTAGCGTGGACTGAGGTAGGCGGTGATTTACTGACTATTGAAAC
CGCTTCTGTGGCTGGTAAAGGGAAATTCTCTTATACAGGGTCGCTTGGTG
ACGTGATGAAAGAGTCGATTCAAGCAGCAATGATGGTCGTTCGTGCTAGG
GCGAAGAAATTGGGTATCGCTGAAAACTTTCACGAAAAACGGGATATCCA
TATTCACGTGCCTGATGGTGCAACACCAAAAGATGGCCCTAGTGCCGGTA
TTGCGATGTGTACTGCATTAATCTCTAGCCTAACGGGCAATCCGGTGCGT
GCCACTGTGGCAATGACGGGTGAGATTAGCTTGCGTGGTAAAGTCTTACC
GATTGGTGGCTTGAAAGAGAAATTGCTGGCGGCGCATCGTGGTGGTATTA
CTACCGTTATTATTCCTAAAGATAATGAAAAAGATCTTGAGGAGATTCCG
GCAAATGCGAAAAATTCATTAATGATTCATGCCGTTGAAACTATTGATGA
GGTGTTAGCCATTGCGTTAGAAAATCCGCCTGCGGGCATTGAAATTATGC
CGGCAAAATCTGCGGGTATTAAAGTAAGAAAAACGCGTTCAAAAACAGCT
ATTCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy