Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR835 IGR833 IGR836 IGR837 IGR832 IGR838 IGR834 tlyC, - HD1145 sdaC, - HD1143 glpT, - HD1150 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 tlyC, - HD1145 sdaC, - HD1143 glpT, - HD1150 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 tlyC, - HD1145 sdaC, - HD1143 glpT, - HD1150 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147
* Calculated from Protein Sequence

Gene ID: HD1147

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glpK  

Definition:
glycerol kinase

Gene Start:
914926

Gene Stop:
915768

Gene Length:
843

Molecular Weight*:
31112

pI*:
7.20

Net Charge*:
0.74

EC:
2.7.1.30  

Functional Class:
Central intermediary metabolism; Other  
Energy metabolism; Sugars  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Darbon E, Servant P, Poncet S, Deutscher J.
Antitermination by GlpP, catabolite repression via CcpA and inducer exclusion triggered by P-GlpK dephosphorylation control
Bacillus subtilis glpFK expression.
Mol Microbiol. 2002 Feb;43(4):1039-52.
PMID: 11929549

Chagneau C, Heyde M, Alonso S, Portalier R, Laloi P.
External-pH-dependent expression of the maltose regulon and ompF gene in Escherichia coli is affected by the level of glycerol
kinase, encoded by glpK.
J Bacteriol. 2001 Oct;183(19):5675-83.
PMID: 11544231

Comment:
For other "glp" genes, see HD1146 (glpF), HD1148 (glpK), HD1150 (glpT), HD1152 (glpQ), HD1153 (glpQ), HD1154 (glpQ), HD1157 (glpA), HD1158 (glpB), HD1160 (glpC), HD1648 (glpR).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glycerol kinases; e.g, residues 15-271 are 83% similar to residues 4-260 of GLPK_HAEIN [1169953], residues 15-272 are 72% similar to residues 4-261 of GLPK_ECOLI [121416], and residues 15-271 are 66% similar to residues 7-263 of GLPK_PSEAE [2493482].

Less similar to xylose kinase, XylB, and to FUCK_HAEIN, a fucokinase.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0554
COG name: Glycerol kinase
Functional Class: C
The phylogenetic pattern of COG0554 is a---yqVcebrh--gpo----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000577 (Carbohydrate kinase, FGGY family) with a combined E-value of 7.6e-80.
    IPB000577A    52-65
    IPB000577B    88-103
    IPB000577C    106-115
    IPB000577D    140-159
    IPB000577E    191-229


ProDom Summary:  Protein Domain Search
Residues 170-232 are 82% similar to a (KINASE GLYCEROL TRANSFERASE ATP:GLYCEROL) protein domain (PD404080) which is seen in GLPK_PASMU.

Residues 17-159 are 78% similar to a (KINASE GLYCEROL TRANSFERASE METABOLISM) protein domain (PD001187) which is seen in GLPK_HAEIN.

Residues 170-243 are 91% similar to a (KINASE GLYCEROL TRANSFERASE GLYCEROKINASE) protein domain (PD415622) which is seen in GLPK_HAEIN.

Residues 180-237 are 43% similar to a (KINASE PROTEOME COMPLETE TRANSFERASE) protein domain (PD130296) which is seen in GLPK_CAEEL.

Residues 177-271 are 38% similar to a (KINASE XYLULOKINASE XYLULOSE TRANSFERASE) protein domain (PD191435) which is seen in O28522_ARCFU.



Paralogs:  Local Blast Search
HD1147 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 17 to 264 (E-value = 1.3e-121) place HD1147 in the FGGY_N family which is described as FGGY family of carbohydrate kinases, N-terminal domain (PF00370)

PDB Hit:
pdb|1BU6|Y Chain Y, Crystal Structures Of Escherichia Coli Glyc... 409 2e-115
pdb|1BOT|Z Chain Z, Crystal Structure Of The Complex Between Es... 409 2e-115
pdb|1BWF|O Chain O, Escherichia Coli Glycerol Kinase Mutant Wit... 407 1e-114

Gene Protein Sequence:
LITDLTKFRVIIMMKEYIIALDQGTTSSRAVLLDKNANIVEVAQREFTQI
YPQPGWVEHNPMEIWASQSSTLNEVVAKAGIAPAKIAAIGITNQRETTIV
WEKATGKPIYNAIVWQCRRTVDICSQLKADSHAEYIRKTTGLVVDPYFSG
TKVKWILDNVEGAREKAEKGELLFGTVDTWLVWKLTQGHVHVTDYTNASR
TMLFNIHTKQWDEKMLQLLNIPHSMLPEVKNSSEIYGQTNIGGQGGIRIP
VAGIAGDQQAALYGHLCVEAGIHTVPVALC$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATTACGGATTTAACAAAATTTAGGGTGATTATTATGATGAAAGAATA
CATTATCGCATTAGACCAAGGCACTACTAGCTCACGCGCGGTGTTACTCG
ATAAAAATGCTAATATTGTGGAAGTAGCACAACGTGAGTTTACACAAATT
TATCCTCAACCAGGTTGGGTAGAACATAATCCAATGGAAATCTGGGCAAG
CCAAAGTTCAACCTTGAATGAAGTGGTGGCAAAAGCCGGTATTGCCCCAG
CAAAAATTGCCGCTATTGGTATTACCAACCAACGCGAAACCACCATTGTA
TGGGAAAAAGCGACCGGTAAACCAATATATAATGCAATTGTATGGCAATG
TCGCCGTACAGTGGATATTTGTAGTCAATTAAAAGCAGACAGTCACGCAG
AATATATCCGTAAAACCACCGGTTTAGTTGTTGATCCTTATTTTTCTGGT
ACTAAAGTAAAATGGATTTTAGATAATGTTGAAGGTGCAAGAGAAAAAGC
AGAAAAAGGTGAATTATTATTTGGCACAGTCGATACTTGGTTAGTTTGGA
AATTAACGCAAGGCCATGTTCATGTGACAGATTATACCAATGCTTCGCGT
ACTATGTTATTTAACATTCATACTAAGCAATGGGATGAGAAAATGTTGCA
ATTACTTAACATCCCTCATTCAATGTTACCTGAAGTAAAAAATTCATCTG
AAATCTATGGCCAAACCAATATTGGCGGTCAAGGTGGTATTCGTATTCCG
GTGGCGGGTATTGCCGGCGATCAACAAGCTGCTCTGTATGGCCATCTATG
TGTAGAAGCGGGAATACATACGGTACCGGTTGCTTTATGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy