Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR835 IGR830 IGR833 IGR836 IGR837 IGR831 IGR832 IGR834 tlyC, - HD1145 sdaC, - HD1143 sdaA, - HD1142 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 HD1141 tlyC, - HD1145 sdaC, - HD1143 sdaA, - HD1142 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 HD1141 tlyC, - HD1145 sdaC, - HD1143 sdaA, - HD1142 cutE, - HD1144 lon, - HD1149 glpK, - HD1148 glpF, - HD1146 glpK, - HD1147 HD1141
* Calculated from Protein Sequence

Gene ID: HD1144

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cutE  

Definition:
apolipoprotein N-acyltransferase, copper

Gene Start:
912821

Gene Stop:
911304

Gene Length:
1518

Molecular Weight*:
56519

pI*:
9.60

Net Charge*:
10.17

EC:
2.3.1.-  

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Glycerolipid metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
Gupta SD, Lee BT, Camakaris J, Wu HC.
Identification of cutC and cutF (nlpE) genes involved in copper tolerance in Escherichia coli.
J Bacteriol. 1995 Aug;177(15):4207-15.
PMID: 7635807

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to apolipoprotein N-acyltransferases; e.g., residues 13-490 are 45% similar to LNT_HAEIN [1170804], residues 10-501 are 38% similar to the sequence for apolipoprotein N-acyltransferase in Salmonella typhimurium [4191605], and residues 10-501 are 38% similar to LNT_ECOLI [117648].

COGS Summary:  COGS Search
BeTs to 10 clades of COG0815
COG name: Apolipoprotein N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG0815 is -----qvce-Rhuj--oLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 377-481 are 59% similar to a (N-ACYLTRANSFERASE APOLIPOPROTEIN 2.3.1.-) protein domain (PD104099) which is seen in LNT_HAEIN.

Residues 13-339 are 43% similar to a (N-ACYLTRANSFERASE APOLIPOPROTEIN PROTEOME) protein domain (PD007694) which is seen in LNT_HAEIN.



Paralogs:  Local Blast Search


HD1144 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 219 to 405 (E-value = 3.9e-18) place HD1144 in the CN_hydrolase family which is described as Carbon-nitrogen hydrolase (PF00795)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNLVNPSILVACILSFCLGAIGCLAFSPFDIWLIAYLSAAGLIWAATLVE
RKTAMLATFAWSIGYFGVGVQWVNVSMTQFGGVPVIVSYLAVLLLASYLG
LYNLLFSYLARRFGLISPFVLASLFTFTEYLRGVVFTGFPWLQFGYTQID
SPFAQLAPIFGVEGLTFLVILLSSYLVDIVKNPTRKIATFTKIAVIIGFS
LASNLLQFVQIDQQKPPVKVALIQANIEQQLKWDPAHFENTLRTYQQLIN
SSLAENEVIILPESAIPALESKINPLLNQLQKMAAAKNTEIIIGTLYENE
QQQLFNSALVLGNQTKPYQLHQSLRYNKHHLVPFGEYVPFGSLLDWMREV
FILPVNLAKGPFIQPALFTNKGKFNMAICYEVIFGHQLQQNQLAQQADYL
ITITNDAWFGDSIGPWQHLQMARMRALELGKPLLRAANTGITAVVGFDGK
VIKKLPQFETNTLTAEIATTKGHTLFGQFGHWLIYSLSFICVAFGLFRRQ
KHKKH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCTTGTAAACCCTTCTATTCTCGTTGCTTGTATCCTGTCATTCTG
CCTAGGGGCTATAGGTTGCTTAGCTTTTTCTCCCTTTGATATTTGGTTAA
TTGCCTATCTTTCTGCGGCAGGTTTAATATGGGCAGCCACGCTTGTAGAA
CGTAAAACGGCAATGTTGGCAACATTTGCCTGGTCGATCGGTTATTTTGG
TGTTGGCGTACAGTGGGTCAATGTCAGTATGACGCAATTCGGTGGCGTGC
CGGTAATCGTTAGTTATTTGGCGGTTTTATTACTTGCCAGTTATCTTGGG
CTTTATAACCTGTTATTTAGCTACCTTGCACGGCGTTTTGGGTTGATTTC
GCCTTTTGTATTAGCAAGTTTATTTACATTTACTGAATATCTACGCGGTG
TCGTCTTTACCGGTTTTCCTTGGCTACAATTTGGCTATACACAGATTGAT
AGCCCTTTTGCTCAACTTGCGCCCATTTTCGGTGTTGAAGGCTTAACTTT
TTTGGTGATCTTATTAAGTAGTTATTTAGTTGATATTGTCAAAAATCCAA
CTAGAAAAATAGCTACTTTTACTAAAATAGCAGTTATTATTGGGTTTTCT
TTAGCATCAAACTTACTGCAATTTGTGCAAATTGATCAGCAAAAACCACC
GGTTAAAGTCGCACTGATTCAGGCAAATATTGAACAACAACTCAAATGGG
ATCCTGCTCATTTTGAAAATACGTTGCGCACTTACCAACAACTAATTAAC
TCATCGCTCGCTGAAAATGAGGTAATCATTTTACCAGAATCAGCTATTCC
GGCGCTTGAATCAAAAATTAATCCGCTGCTCAATCAGTTGCAGAAAATGG
CTGCCGCTAAAAATACAGAAATTATTATTGGGACTTTGTATGAAAATGAG
CAACAGCAATTATTCAATAGTGCTTTAGTTTTGGGTAACCAAACTAAGCC
TTATCAACTACATCAATCACTACGTTATAACAAGCATCACTTAGTACCAT
TTGGTGAATATGTTCCGTTTGGTTCATTATTAGATTGGATGCGTGAAGTG
TTTATTTTACCGGTTAATTTAGCAAAAGGCCCCTTTATCCAACCTGCATT
ATTCACAAATAAGGGAAAATTTAATATGGCCATTTGCTATGAAGTGATTT
TTGGCCATCAATTACAACAAAACCAGTTGGCTCAACAGGCAGATTATTTA
ATTACGATTACTAATGATGCTTGGTTTGGTGATTCTATCGGCCCTTGGCA
GCATTTGCAAATGGCAAGAATGCGTGCATTAGAATTAGGTAAACCTTTAT
TACGTGCCGCCAATACTGGTATTACGGCGGTTGTTGGTTTTGATGGTAAA
GTGATTAAAAAACTTCCTCAGTTTGAAACAAATACGCTAACCGCTGAAAT
AGCCACGACAAAAGGTCATACACTCTTCGGGCAATTTGGGCATTGGCTGA
TTTATAGCTTAAGTTTTATTTGTGTGGCGTTCGGGCTATTCAGACGTCAA
AAACACAAAAAGCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy