Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR827 IGR829 IGR826 IGR830 IGR833 IGR828 IGR831 IGR832 IGR834 HD1137 HD1139 rluC, - HD1138 tlyC, - HD1145 sdaC, - HD1143 sdaA, - HD1142 ycjX, - HD1136 cutE, - HD1144 HD1140 HD1141 HD1137 HD1139 rluC, - HD1138 tlyC, - HD1145 sdaC, - HD1143 sdaA, - HD1142 ycjX, - HD1136 cutE, - HD1144 HD1140 HD1141 HD1139 rluC, - HD1138 tlyC, - HD1145 sdaC, - HD1143 sdaA, - HD1142 ycjX, - HD1136 cutE, - HD1144 HD1137 HD1140 HD1141
* Calculated from Protein Sequence

Gene ID: HD1142

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sdaA  

Definition:
L-serine dehydratase (L-serine deaminase)

Gene Start:
909786

Gene Stop:
908407

Gene Length:
1380

Molecular Weight*:
50198

pI*:
5.70

Net Charge*:
-10.83

EC:
4.2.1.13  

Functional Class:
Energy metabolism; Amino acids and amines  

Pathway: pathway table
Cysteine metabolism
Glycine, serine and threonine metabolism

Secondary Evidence:
Su H, Moniakis J, Newman EB.
Use of gene fusions of the structural gene sdaA to purify L-serine deaminase 1 from Escherichia coli K-12.
Eur J Biochem. 1993 Feb 1;211(3):521-7.
PMID: 8436113

Su H, Newman EB.
A novel L-serine deaminase activity in Escherichia coli K-12.
J Bacteriol. 1991 Apr;173(8):2473-80.
PMID: 2013569

Su HS, Lang BF, Newman EB.
L-serine degradation in Escherichia coli K-12: cloning and sequencing of the sdaA gene.
J Bacteriol. 1989 Sep;171(9):5095-102.
PMID: 2504697

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous strong hits in gapped BLAST to L-serine dehydratases (L-serine deaminases); e.g., residues 1-456 are 70% similar to SDHL_HAEIN [2501150], residues 1-459 are 67% similar to SDHM_ECOLI (L-serine dehydratase 2), and residues 1-459 are 66% similar to SDHL_ECOLI (L-serine dehydratase 1).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1760
COG name: L-serine deaminase
Functional Class:  E
The phylogenetic pattern of COG1760 is --------EBrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 107-173 are 54% similar to a (L-SERINE DEHYDRATASE DEAMINASE 4FE-4S) protein domain (PD009440) which is seen in SDHL_HAEIN.

Residues 3-87 are 69% similar to a (L-SERINE DEHYDRATASE PROTEOME) protein domain (PD005716) which is seen in SDHL_HAEIN.

Residues 175-452 are 78% similar to a (L-SERINE DEHYDRATASE PROTEOME LYASE) protein domain (PD008627) which is seen in SDHL_HAEIN.

Residues 177-271 are 33% similar to a (PROTEOME COMPLETE DEHYDRATASE L-SERINE) protein domain (PD395575) which is seen in Q9PM51_CAMJE.

Residues 177-270 are 62% similar to a (L-SERINE DEHYDRATASE PROTEOME COMPLETE) protein domain (PD288793) which is seen in Q9CPK1_PASMU.

Residues 83-175 are 51% similar to a (L-SERINE DEHYDRATASE PROTEOME COMPLETE) protein domain (PD395768) which is seen in Q9CPK1_PASMU.



Paralogs:  Local Blast Search


HD1142 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 163 (E-value = 4.8e-78) place HD1142 in the SDH_beta family which is described as Serine dehydratase beta chain (PF03315)
Residues 176 to 454 (E-value = 1.1e-189) place HD1142 in the SDH_alpha family which is described as Serine dehydratase alpha chain (PF03313)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MISVFDIFKVGIGPSSSHTVGPMKAAKQFVDELSEHKLLAKTDRLVADVY
GSLSLTGRGHSTDIAIVMGLMGYLPDNVDIERIDSVIQQVKQEHKLVLAE
ANPAETKIIDFDFYNDMPFHSTFLARHENGMTLKAFAGETLLYEKTFYSI
GGGFIVDDEHFEQQTNADVNVPFPYKNAEDLLKHCHDQGLPLSSLVWKNE
MALHHKQAISDYLTKIWKTMEACIEHGLHTEGLLPGPLKVIRRAPSLRHT
LESTGKFNTDPMQIIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAV
LAYYQQFIAPLNQEKIERYLLVCSVIGSLYKMNASISGAEVGCQGEVGVA
CSMAAAGLTEIMGGTPEQVCMAAEIGMEHNLGLTCDPVSGQVQVPCIERN
AIASVKAINASRMALRRTTQPRVSLDKVIETMYETGKDMNAKYRETSTGG
LAIKILPCD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAGTGTATTTGATATTTTTAAAGTGGGCATTGGTCCTTCTAGTTC
GCATACTGTTGGGCCAATGAAAGCAGCAAAGCAATTTGTTGATGAATTAA
GTGAGCATAAACTTTTAGCTAAAACGGATCGCTTAGTTGCCGATGTTTAT
GGTTCTTTATCGTTAACCGGTCGAGGCCACAGCACCGATATTGCAATAGT
AATGGGGTTAATGGGCTATTTACCAGATAACGTAGATATAGAACGAATAG
ATAGCGTCATTCAACAAGTAAAACAAGAGCATAAACTTGTACTTGCCGAA
GCCAATCCAGCGGAAACCAAAATAATTGATTTTGATTTCTATAATGATAT
GCCATTCCATAGCACGTTCTTAGCACGCCACGAAAATGGTATGACATTAA
AAGCCTTTGCGGGTGAAACACTGCTATACGAAAAAACCTTTTATTCTATT
GGCGGTGGCTTTATCGTTGATGATGAACACTTTGAGCAACAAACTAACGC
CGATGTGAATGTGCCTTTTCCTTATAAAAATGCGGAAGATTTACTTAAGC
ATTGCCATGATCAAGGTTTACCGCTTTCTAGCTTAGTTTGGAAAAATGAA
ATGGCATTACATCATAAACAAGCCATATCAGATTATTTAACCAAGATTTG
GAAAACAATGGAAGCCTGTATTGAGCACGGTTTACACACTGAGGGCTTAT
TACCAGGCCCATTAAAAGTTATTCGCCGAGCGCCATCATTACGCCATACC
CTAGAATCAACCGGTAAATTTAACACCGATCCAATGCAAATTATTGACTG
GGTTAATATGTTTGCCCTTGCGGTTAATGAAGAAAATGCAGCCGGTGGCC
GTGTCGTTACTGCGCCAACTAACGGTGCTTGCGGTATTGTCCCCGCAGTA
TTAGCGTATTATCAGCAATTTATTGCCCCATTAAATCAAGAAAAAATTGA
GCGTTATTTATTAGTATGCAGTGTAATTGGTTCACTCTACAAAATGAATG
CCTCTATTTCAGGTGCTGAAGTCGGTTGCCAAGGCGAAGTGGGAGTAGCT
TGTTCAATGGCTGCGGCTGGTTTAACTGAAATTATGGGCGGAACGCCTGA
ACAAGTATGTATGGCAGCTGAAATTGGTATGGAACATAATCTAGGCTTAA
CTTGCGATCCTGTCAGTGGCCAAGTGCAAGTCCCTTGTATCGAACGTAAT
GCCATCGCATCAGTTAAAGCAATCAATGCTAGCCGTATGGCTCTACGCCG
GACTACACAACCGCGTGTCAGTCTAGATAAAGTGATCGAAACAATGTACG
AAACCGGTAAAGATATGAATGCTAAATACCGAGAAACCTCAACCGGTGGT
TTAGCCATTAAAATTTTACCTTGTGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy