Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR821 IGR827 IGR820 IGR825 IGR822 IGR829 IGR826 IGR824 IGR828 IGR823 HD1137 HD1139 rlpB, - HD1131 smpB, - HD1134 rluC, - HD1138 holA, - HD1130 serS, - HD1133 ycjX, - HD1136 leuS, - HD1132 HD1140 HD1141 HD1137 HD1139 rlpB, - HD1131 smpB, - HD1134 rluC, - HD1138 holA, - HD1130 serS, - HD1133 ycjX, - HD1136 leuS, - HD1132 HD1140 HD1141 HD1139 rlpB, - HD1131 smpB, - HD1134 rluC, - HD1138 holA, - HD1130 serS, - HD1133 ycjX, - HD1136 leuS, - HD1132 HD1137 HD1141 HD1140
* Calculated from Protein Sequence

Gene ID: HD1133

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
serS  

Definition:
seryl-tRNA synthetase, seryl-tRNA ligase

Gene Start:
902718

Gene Stop:
901411

Gene Length:
1308

Molecular Weight*:
48806

pI*:
6.10

Net Charge*:
-5.74

EC:
6.1.1.11  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glycine, serine and threonine metabolism

Secondary Evidence:
Hartlein,M., Madern,D. and Leberman,R.
Cloning and characterization of the gene for Escherichia coli
seryl-tRNA synthetase
Nucleic Acids Res. 15 (3), 1005-1017 (1987)
Medline: 87146412


Vincent,C., Borel,F., Willison,J.C., Leberman,R. and Hartlein,M.
Seryl-tRNA synthetase from Escherichia coli: functional evidence
for cross-dimer tRNA binding during aminoacylation
Nucleic Acids Res. 23 (7), 1113-1118 (1995)
Medline: 95258316

Leberman,R.,Hartlein,M. and Cusack,S.
Escherichia coli seryl-tRNA synthetase: the structure of a class 2
aminoacyl-tRNA synthetase
Biochim. Biophys. Acta 1089 (3), 287-298 (1991)
Medline: 91316127


Comment:


Blast Summary:  PSI-Blast Search
Many strong hits in gapped BLAST to seryl-tRNA synthetase proteins; e.g., residues 1-433 are 77% similar to SYS_HAEIN [1174543], residues 1-433 are 72% similar to SYS_ECOLI [135173], and residues 1-429 are 61% similar to the sequence for seryl-tRNA synthetase in Neisseria meningitidis MC58 [7226938].

COGS Summary:  COGS Search
BeTs to 17 clades of COG0172
COG name: Seryl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0172 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003364 (Seryl-tRNA synthetase N-terminal domain) with a combined E-value of 4e-147.
    IPB003364A    1-10
    IPB003364B    104-128
    IPB003364C    140-177
    IPB003364D    190-221
    IPB003364E    234-261
    IPB003364F    270-295
    IPB003364G    341-378
    IPB003364H    388-415
    IPB003364I    419-428


ProDom Summary:  Protein Domain Search
Residues 102-433 are 80% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD003933) which is seen in SYS_HAEIN.

Residues 1-100 are 68% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD058075) which is seen in SYS_HAEIN.



Paralogs:  Local Blast Search


HD1133 is paralogously related to HD1919 (2e-04).


Pfam Summary:  Pfam Search
Residues 1 to 108 (E-value = 1.2e-38) place HD1133 in the Seryl_tRNA_N family which is described as Seryl-tRNA synthetase N-terminal domain (PF02403)
Residues 162 to 327 (E-value = 1.2e-54) place HD1133 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

PDB Hit:
pdb|1SES|A Chain A, Seryl-Trna Synthetase (E.C.6.1.1.11) (Serin... 230 3e-061

Gene Protein Sequence:
MIDQNLLRTNLDDVANALKLKRNFILDVNQVKALEEQRKTLQVTTETLQA
ERNARSKNIGAAKARGENISQLLAEVDTMGNQLEIAKTELDKVQSEIREL
LLTIPNLPAEEVPLGKDDSQNKEILRWGTPRQFDFEIKDHVTLGENLKGI
DFPTGVKLTASRFVVMKDKIARLHRALAQFMLDLHSEQHGYMEVNVPLLV
NHDTLYGTGQLPKFGEDLFHTQPLTGQDPNEVQRPYGLIPTAEVPLTNLV
RDEIVDEDSLPIKLVAHTPCFRAEAGSYGRDTRGLIRMHQFEKVELVQIV
APEKSMEALEELTGQAEKILQLLHLPYRKVLLCTGDMGFGSAKTYDLEVW
LPAQNTYREISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVG
RTLVAVLENYQNADGSITIPEVLRPYMAGQEAITG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCGACCAAAATTTACTTCGCACTAATTTAGACGATGTTGCAAATGC
GCTCAAATTAAAACGTAATTTCATCTTAGATGTTAACCAAGTAAAAGCAC
TTGAAGAACAACGTAAAACATTACAAGTCACAACGGAAACCTTGCAAGCT
GAACGTAATGCTCGTTCGAAAAATATTGGCGCAGCTAAAGCACGTGGTGA
AAACATTAGCCAACTATTAGCTGAAGTAGACACTATGGGTAATCAGCTTG
AGATAGCAAAAACAGAATTAGATAAAGTACAAAGTGAAATACGTGAATTA
TTGTTAACTATTCCAAATTTACCGGCGGAAGAAGTCCCGCTTGGTAAAGA
TGATAGCCAAAATAAAGAAATATTACGCTGGGGAACGCCTCGTCAATTTG
ATTTTGAAATCAAAGATCACGTCACGCTTGGTGAAAACTTAAAAGGCATC
GATTTTCCTACGGGCGTCAAGTTAACCGCAAGTCGCTTTGTTGTAATGAA
AGACAAAATTGCCCGCTTACACCGTGCATTAGCACAATTTATGTTAGATC
TACATAGCGAACAACACGGTTATATGGAAGTAAATGTCCCCTTATTGGTC
AATCACGACACCTTGTATGGCACAGGTCAACTGCCAAAATTTGGTGAAGA
TCTATTCCATACTCAACCATTAACTGGACAAGATCCTAATGAAGTGCAAC
GCCCTTATGGTTTAATTCCCACCGCTGAAGTTCCGCTAACCAATCTCGTG
CGTGATGAAATTGTGGATGAAGATAGTCTGCCAATTAAACTCGTTGCCCA
TACACCTTGTTTCCGTGCAGAAGCAGGTTCTTATGGACGTGATACACGCG
GTCTAATACGTATGCATCAATTTGAAAAAGTCGAATTAGTACAAATTGTG
GCACCGGAAAAATCCATGGAAGCACTTGAAGAATTAACAGGTCAAGCAGA
AAAAATCTTACAACTACTCCATTTACCTTACCGTAAAGTATTACTATGCA
CAGGCGATATGGGCTTTGGCTCAGCAAAAACATATGACTTAGAAGTCTGG
TTACCGGCACAAAATACTTACCGTGAAATTTCTTCTTGCTCAAATATGTG
GGATTTCCAAGCTCGTCGGATGTCTGCTCGCTGTAAAGCAAAAGGCGATA
AAAAAACACGTTTAGTTCATACCTTAAATGGCTCAGGGCTAGCAGTTGGA
CGGACGTTAGTCGCTGTATTAGAAAATTATCAAAATGCCGACGGCTCGAT
CACTATCCCAGAAGTATTGCGTCCGTATATGGCTGGACAAGAAGCAATTA
CCGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy