Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR819 IGR821 IGR818 IGR820 IGR825 IGR822 IGR826 IGR824 IGR817 IGR823 HD1137 rlpB, - HD1131 smpB, - HD1134 holA, - HD1130 serS, - HD1133 ycjX, - HD1136 leuS, - HD1132 HD1129 HD1126 yacE, - HD1127 pilC,hofC, - HD1125 HD1137 rlpB, - HD1131 smpB, - HD1134 holA, - HD1130 serS, - HD1133 ycjX, - HD1136 leuS, - HD1132 HD1129 HD1126 yacE, - HD1127 pilC,hofC, - HD1125 HD1137 rlpB, - HD1131 smpB, - HD1134 holA, - HD1130 serS, - HD1133 ycjX, - HD1136 leuS, - HD1132 HD1126 yacE, - HD1127 pilC,hofC, - HD1125 HD1129
* Calculated from Protein Sequence

Gene ID: HD1132

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
leuS  

Definition:
leucyl-tRNA synthetase, leucyl-tRNA ligase

Gene Start:
901260

Gene Stop:
898675

Gene Length:
2586

Molecular Weight*:
98047

pI*:
5.70

Net Charge*:
-14.00

EC:
6.1.1.4  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Secondary Evidence:
Li T, Wang ED, Wang YL.
The Overproduction of Leucyl-tRNA Synthetase in E. coli and Its Purification.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai). 1997;29(6):591-596.
PMID: 12215774

Tang Y, Tirrell DA.
Attenuation of the editing activity of the Escherichia coli leucyl-tRNA synthetase allows incorporation of
novel amino acids into proteins in vivo.
Biochemistry. 2002 Aug 27;41(34):10635-45.
PMID: 12186549

Du X, Wang ED.
Discrimination of tRNA(Leu) isoacceptors by the mutants of Escherichia coli leucyl-tRNA synthetase in editing.
Biochemistry. 2002 Aug 27;41(34):10623-8.
PMID: 12186547

Comment:


Blast Summary:  PSI-Blast Search
Many very strong hits in gapped BLAST to leucyl-tRNA synthetase proteins, e.g., residues 10-869 are 79% similar to SYL_HAEIN [1174531], residues 10-868 are 72% similar to SYL_ECOLI [2507435], and residues 18-868 are 38% similar to SYL_TREPA [6094405]

COGS Summary:  COGS Search
BeTs to 15 clades of COG0495
COG name: Leucyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0495 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 7e-09.
    IPB001412A    42-52
    IPB001412B    616-626


ProDom Summary:  Protein Domain Search
Residues 97-159 are 88% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA ATP-BINDING) protein domain (PD002670) which is seen in SYL_PASMU.

Residues 619-713 are 76% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000476) which is seen in SYL_ECOLI.

Residues 309-401 are 68% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD004139) which is seen in SYL_ECOLI.

Residues 417-501 are 85% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000647) which is seen in SYL_HAEIN.

Residues 362-416 are 65% similar to a (SYNTHETASE LIGASE LEUCYL-TRNA) protein domain (PD404056) which is seen in SYL_HAEIN.

Residues 722-839 are 74% similar to a (SYNTHETASE LIGASE LEUCYL-TRNA) protein domain (PD118334) which is seen in SYL_PASMU.

Residues 10-93 are 86% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000389) which is seen in SYL_HAEIN.

Residues 400-503 are 39% similar to a (ZK524.3) protein domain (PD118452) which is seen in Q23511_CAEEL.

Residues 694-858 are 35% similar to a (SYNTHETASE LIGASE LEUCYL-TRNA ATP-BINDING) protein domain (PD346307) which is seen in SYL_HELPJ.

Residues 567-609 are 93% similar to a (SYNTHETASE LEUCYL-TRNA LIGASE) protein domain (PD330586) which is seen in SYL_HAEIN.

Residues 246-315 are 68% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEOME) protein domain (PD406762) which is seen in SYL_PASMU.

Residues 310-369 are 64% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD350559) which is seen in Q9PBG8_XYLFA.

Residues 225-306 are 62% similar to a (SYNTHETASE LIGASE LEUCYL-TRNA) protein domain (PD409879) which is seen in SYL_HAEIN.

Residues 516-566 are 90% similar to a (SYNTHETASE LIGASE LEUCYL-TRNA) protein domain (PD403220) which is seen in SYL_HAEIN.



Paralogs:  Local Blast Search


HD1132 is paralogously related to HD0669 (6e-23), HD0272 (2e-16) and HD1054 (2e-06).


Pfam Summary:  Pfam Search
Residues 13 to 659 (E-value = 1.3e-271) place HD1132 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

PDB Hit:
pdb|1FFY|A Chain A, Insights Into Editing From An Ile-Trna Synt... 121 3e-028
pdb|1GAX|A Chain A, Crystal Structure Of Thermus Thermophilus V... 89 2e-018
pdb|1ILE| Isoleucyl-Trna Synthetase 71 4e-013

Gene Protein Sequence:
MQQQYNPSAIESKVQHFWEENKVFKAVKDITKEKYYCLSMLPYPSGRLHM
GHVRNYTIGDVISRYQRMIGKNVLQPMGWDAFGLPAEGAAVKNNTAPAKW
TYENIEYMKNQLKVLGFSYDWDREITTCRPEYYKWEQWFFTELYKKGLVY
KKTSTVNWCPNDETVLANEQVHEGCCWRCDTPVEQRDIPQWFIKITDYAE
ELLTQLDNLTQWPDQVKTMQRNWIGRSEGVEITFKIAGSNATLPVYTTRP
DTFFGVSYLAVAAAHPLAELASTNNPALAEFIREAKNTKVAEAELATMEK
KGMPTGLFAIHPLTGKEIPVWVANFVLMHYGTGAVMAVPAHDERDFDFAK
KYGLQINQVIQPLDASTWDFSQAAFTEHGKLINSAEFDGLDFNHAFNAIA
DKLESLGVGKRQVNFRLRDWGVSRQRYWGAPIPMMTTEQGEVVTVPLKDL
PVILPENVVMDGVQSPIKSDPEWAKTTYEGQPALKETDTFDTFMESSWYY
ARYTCPQYHQGMLDADEANYWLPVDQYIGGIEHATMHLLYFRFFHKLLRD
AGILTSDEPATKLLCQGMVLADAFYYTSPTNERIWVSPTQVSLERDEKGR
IINATDPAGHKLVHSGMTKMSKSKNNGIDPQEMVEKYGADTVRLFMMFAS
PAEMTLEWQESGVEGAKRFLGRVWNLVYEYVQQPATQALNALELNKAQKE
LRRDVHKTIAKVSDDIGRRQTFNTAIAAIMELMNKLNKAPLESDQDKAVM
AEALSAVVRMLYPITPHICFELWQALGNQQTIDFAPWVVSDETAMIEDEK
LVVVQVNGKVRGKITVPANASEDEVKITAKNDANVAKFLADMQIVKEIYI
PFKMLNFVVKV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACAACAATATAACCCAAGTGCTATTGAATCTAAGGTTCAACATTT
CTGGGAAGAAAATAAAGTTTTCAAAGCAGTAAAAGATATAACAAAAGAAA
AATATTACTGCCTTTCAATGTTACCGTATCCATCTGGTCGCTTGCATATG
GGGCATGTACGTAACTATACCATTGGCGATGTTATTTCACGTTACCAACG
GATGATCGGTAAAAATGTATTACAACCTATGGGATGGGATGCTTTCGGCT
TGCCTGCTGAAGGTGCGGCAGTTAAAAATAATACCGCTCCCGCAAAGTGG
ACCTATGAAAATATTGAATATATGAAAAATCAATTAAAAGTATTAGGTTT
TTCATATGATTGGGATCGCGAAATCACCACTTGCCGTCCTGAATATTACA
AATGGGAACAATGGTTCTTCACTGAATTATATAAAAAAGGCTTAGTTTAT
AAAAAAACCTCTACCGTAAACTGGTGTCCAAATGATGAAACCGTATTAGC
CAATGAACAAGTCCACGAAGGTTGTTGTTGGCGTTGTGATACACCGGTTG
AACAACGTGATATCCCTCAATGGTTTATTAAAATCACGGATTATGCAGAA
GAATTATTAACGCAGTTAGATAACTTAACGCAATGGCCCGATCAAGTAAA
AACGATGCAACGCAACTGGATTGGCCGTTCTGAAGGGGTAGAGATTACGT
TTAAAATCGCTGGCTCAAATGCGACTTTACCCGTTTATACTACTCGCCCT
GATACATTCTTTGGCGTAAGCTATTTAGCCGTGGCCGCAGCCCATCCACT
GGCTGAATTAGCTTCAACCAATAATCCAGCATTAGCCGAATTTATTCGTG
AAGCTAAAAATACCAAAGTGGCAGAAGCAGAGTTGGCAACCATGGAAAAA
AAAGGAATGCCAACCGGTTTATTTGCTATCCATCCATTAACAGGTAAAGA
AATACCGGTTTGGGTAGCTAATTTCGTATTAATGCACTATGGCACAGGCG
CCGTGATGGCAGTCCCTGCTCACGATGAACGTGACTTCGATTTTGCTAAA
AAATATGGATTACAAATTAATCAAGTAATCCAACCGCTTGATGCATCAAC
TTGGGACTTTTCACAAGCCGCCTTTACTGAGCACGGTAAATTAATTAATT
CAGCAGAATTTGATGGACTAGATTTCAATCATGCATTTAATGCCATTGCC
GATAAATTAGAATCCCTTGGAGTTGGTAAACGCCAAGTTAACTTCCGCTT
ACGTGATTGGGGCGTTTCTCGTCAACGTTATTGGGGCGCTCCCATTCCAA
TGATGACCACTGAACAAGGCGAAGTGGTTACCGTTCCATTGAAAGATTTA
CCGGTTATTTTGCCAGAAAATGTGGTAATGGATGGTGTACAAAGCCCCAT
TAAATCTGATCCTGAATGGGCAAAAACAACTTATGAAGGACAACCTGCAT
TAAAAGAAACAGACACTTTCGATACTTTCATGGAATCATCATGGTATTAT
GCACGTTATACTTGCCCACAATATCACCAAGGTATGTTAGATGCTGATGA
AGCCAATTATTGGTTACCCGTCGATCAATATATCGGTGGTATTGAGCATG
CAACCATGCATTTACTTTACTTCCGCTTCTTCCACAAATTACTACGTGAT
GCGGGCATTTTAACTTCAGATGAACCGGCAACTAAACTACTCTGTCAAGG
AATGGTATTAGCTGATGCGTTTTATTACACCAGCCCAACTAATGAACGTA
TCTGGGTAAGCCCAACGCAAGTCAGTTTAGAACGTGATGAAAAAGGCCGC
ATTATTAACGCAACAGATCCAGCGGGCCACAAATTAGTCCATAGTGGTAT
GACCAAGATGTCAAAATCAAAAAACAATGGTATTGACCCGCAAGAAATGG
TTGAAAAATATGGTGCTGATACTGTCCGCTTATTTATGATGTTTGCATCA
CCCGCCGAAATGACCCTTGAGTGGCAAGAATCTGGTGTCGAAGGCGCTAA
ACGTTTCTTAGGTCGAGTATGGAATTTAGTTTATGAATATGTACAACAGC
CGGCAACACAAGCATTAAATGCACTTGAATTAAATAAAGCGCAAAAAGAA
TTACGCCGTGATGTACATAAAACCATTGCTAAAGTCAGCGATGATATTGG
TCGACGTCAAACATTTAATACCGCCATTGCGGCCATAATGGAATTGATGA
ATAAATTAAATAAAGCACCGCTTGAATCTGATCAAGATAAAGCCGTAATG
GCAGAAGCATTAAGTGCCGTAGTTCGTATGCTTTATCCAATTACACCGCA
TATCTGTTTTGAGCTCTGGCAAGCATTAGGCAATCAACAAACTATTGATT
TTGCACCTTGGGTCGTTTCTGATGAAACGGCGATGATAGAAGATGAAAAA
TTAGTGGTTGTACAAGTCAATGGTAAAGTGCGTGGCAAAATAACCGTGCC
CGCAAATGCTTCAGAAGATGAAGTGAAAATAACTGCCAAAAATGATGCTA
ACGTAGCAAAATTCTTAGCTGATATGCAAATAGTCAAAGAGATCTATATA
CCATTTAAAATGTTAAATTTTGTAGTTAAAGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy