Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR819 IGR821 IGR816 IGR818 IGR820 IGR822 IGR817 IGR823 rlpB, - HD1131 holA, - HD1130 serS, - HD1133 leuS, - HD1132 HD1129 pilA,ppdD, - HD1123 HD1126 yacE, - HD1127 pilB,hofB, - HD1124 rlpB, - HD1131 holA, - HD1130 serS, - HD1133 leuS, - HD1132 HD1129 pilA,ppdD, - HD1123 HD1126 yacE, - HD1127 pilB,hofB, - HD1124 rlpB, - HD1131 holA, - HD1130 serS, - HD1133 leuS, - HD1132 pilA,ppdD, - HD1123 HD1126 yacE, - HD1127 pilB,hofB, - HD1124 pilC,hofC, - HD1125 pilC,hofC, - HD1125 HD1129
* Calculated from Protein Sequence

Gene ID: HD1130

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
holA  

Definition:
DNA polymerase III, delta subunit

Gene Start:
898123

Gene Stop:
897098

Gene Length:
1026

Molecular Weight*:
39636

pI*:
7.20

Net Charge*:
0.61

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Dong,Z., Onrust,R., Skangalis,M. and O'Donnell,M.
DNA polymerase III accessory proteins. I. holA and holB encoding
delta and delta'
J. Biol. Chem. 268 (16), 11758-11765 (1993)
Medline: 93280136

Carter,J.R., Franden,M.A., Aebersold,R. and McHenry,C.S.
Molecular cloning, sequencing, and overexpression of the structural gene encoding the delta subunit of Escherichia coli DNA polymerase III holoenzyme
J. Bacteriol. 174 (21), 7013-7025 (1992)
Medline: 93015766

O'Donnell,M.
Accessory protein function in the DNA polymerase III holoenzyme
from E. coli
Bioessays 14 (2), 105-111 (1992)
Medline: 92246902



Comment:
For other "hol" genes, see HD1935 (holB) and HD0667 (holC).

Blast Summary:  PSI-Blast Search
Two moderately strong hits in gapped BLAST to DNA polymerase III, delta subunit; e.g., residues 1-337 are 41% similar to HOLA_HAEIN [1170333], and residues 1-339 are 36% similar to HOLA_ECOLI [123452].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-158 are 38% similar to a (DNA POLYMERASE III SUBUNIT) protein domain (PD041218) which is seen in HOLA_HAEIN.

Residues 171-337 are 46% similar to a (DNA POLYMERASE SUBUNIT DELTA) protein domain (PD277480) which is seen in HOLA_HAEIN.



Paralogs:  Local Blast Search


HD1130 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 341 (E-value = 9.3e-124) place HD1130 in the DNA_pol3_delta family which is described as DNA polymerase III, delta subunit (PF06144)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQKVFPEALTHHLSKSLSPFYLLTGNDLLLLNESKAQIIHAAKAVEFDEI
QEITINNETKWEQLFESVQNFGLFFSRQIIILNLPENPTTAQMNHIAKLA
GLINADLMLILCLTKFSKAMEKQAWFTQMDAKLVQVSCQTPDINRLPIWL
ANRAKMMGLQLEVEVVQLLAYSYEGNLIALQQTLQQLQLRTHDGKITLPQ
AKEIIEQFAQFTPFQWIDALLEGKIARAIRILKYLKDEEIQVVMLLRIVQ
KELLILLEITRSPAAILTSQQALYVGNLRAEFDRLKIWQNRRPFYQSAIQ
RLSYKKLYLLIQQLAELEKQTKHIFSEQIWLELEHFSTLFE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAAAGTTTTTCCTGAAGCGCTTACTCACCATTTATCAAAAAGCCT
CTCACCCTTTTACTTACTGACGGGCAACGATCTACTGTTGCTAAATGAAA
GTAAAGCCCAAATTATTCATGCAGCTAAAGCGGTAGAATTTGATGAAATA
CAAGAAATTACGATTAATAATGAAACCAAATGGGAGCAACTCTTCGAATC
TGTCCAAAATTTCGGTCTATTTTTTAGCCGTCAAATTATCATTCTAAATC
TGCCAGAAAATCCAACAACCGCACAAATGAACCATATTGCTAAACTCGCC
GGGTTGATTAATGCTGATCTAATGCTGATTTTATGCTTAACTAAATTTAG
TAAAGCGATGGAAAAACAAGCTTGGTTTACACAAATGGACGCTAAACTCG
TACAAGTCAGCTGTCAAACACCTGATATTAATCGATTACCCATTTGGTTA
GCTAATCGGGCTAAAATGATGGGATTACAGCTAGAAGTAGAAGTAGTGCA
ATTATTGGCATACAGCTATGAAGGTAATTTAATTGCGCTACAACAAACCT
TACAACAGCTACAACTGCGTACTCATGATGGTAAAATAACATTACCACAA
GCGAAAGAAATTATTGAACAATTTGCACAATTTACGCCTTTTCAATGGAT
TGATGCCTTATTAGAAGGCAAAATTGCACGTGCTATTCGAATACTCAAAT
ATTTAAAAGATGAAGAAATACAAGTGGTTATGCTACTCAGAATTGTGCAA
AAAGAACTGTTAATTCTATTGGAAATAACACGTTCACCAGCCGCAATCTT
AACTAGCCAACAAGCACTTTATGTGGGTAATTTAAGAGCCGAATTCGACC
GCTTAAAAATATGGCAAAATCGTCGTCCATTCTATCAGAGTGCTATTCAA
CGGCTTAGCTATAAAAAGCTGTATCTGCTTATTCAACAACTCGCTGAATT
AGAAAAACAAACTAAACACATATTTAGCGAACAAATTTGGTTAGAACTAG
AACATTTTTCTACGCTATTTGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy