Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR809 IGR816 IGR811 IGR813 IGR807 IGR814 IGR810 IGR812 IGR808 IGR815 HD1119 nth, - HD1115 fdoI,fdxI, - HD1111 HD1117 fdhE, - HD1110 sms,radA, - HD1121 HD1120 pilA,ppdD, - HD1123 folA,dyr, - HD1118 fdhD, - HD1113 pilB,hofB, - HD1124 HD1109 HD1119 nth, - HD1115 fdoI,fdxI, - HD1111 HD1117 fdhE, - HD1110 sms,radA, - HD1121 HD1120 pilA,ppdD, - HD1123 folA,dyr, - HD1118 fdhD, - HD1113 pilB,hofB, - HD1124 HD1109 HD1119 nth, - HD1115 fdoI,fdxI, - HD1111 HD1117 fdhE, - HD1110 sms,radA, - HD1121 fdxH, - HD1112 fdxH, - HD1112 pilA,ppdD, - HD1123 folA,dyr, - HD1118 fdhD, - HD1113 pilB,hofB, - HD1124 HD1109 pilC,hofC, - HD1125 pilC,hofC, - HD1125 HD1120
* Calculated from Protein Sequence

Gene ID: HD1118

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
folA  dyr  

Definition:
dihydrofolate reductase

Gene Start:
890052

Gene Stop:
890537

Gene Length:
486

Molecular Weight*:
18839

pI*:
6.70

Net Charge*:
-0.84

EC:
1.5.1.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Folate biosynthesis
One carbon pool by folate

Secondary Evidence:
Herrington MB, MacRae TJ, Panagopoulos D, Wong SH.
A mutation in the folA promoter delays adaptation to minimal medium by Escherichia coli K-12.
J Basic Microbiol. 2002;42(3):172-80.
PMID: 12111744

Zywno-van Ginkel S, Dooley TP, Suling WJ, Barrow WW.
Identification and cloning of the Mycobacterium avium folA gene, required for dihydrofolate reductase activity.
FEMS Microbiol Lett. 1997 Nov 1;156(1):69-78.
PMID: 9368362

Comment:
For other "fol" genes, see HD1108 (folD), HD0978 (folB), HD1465 (folC), HD0644 (folP).

Blast Summary:  PSI-Blast Search
Numerous moderate hits in gapped BLAST to dihydrofolate reductase; e.g., residues 1-160 are 52% similar to DYR_HAEIN [1169443], and residues 1-160 are 45% similar to DYR3_SALTY [118971],

COGS Summary:  COGS Search
BeTs to 7 clades of COG0262
COG name: Dihydrofolate reductase
Functional Class:  H
The phylogenetic pattern of COG0262 is ----y-v-eBrh--GP--in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001796 (Dihydrofolate reductase) with a combined E-value of 4.5e-35.
    IPB001796A    6-17
    IPB001796B    22-36
    IPB001796C    39-51
    IPB001796D    53-65
    IPB001796E    94-103
    IPB001796F    113-129


ProDom Summary:  Protein Domain Search
Residues 6-128 are 60% similar to a (DIHYDROFOLATE REDUCTASE OXIDOREDUCTASE NADP ONE-CARBON) protein domain (PD000692) which is seen in Q9CJU8_PASMU.



Paralogs:  Local Blast Search


HD1118 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 160 (E-value = 8.6e-52) place HD1118 in the DiHfolate_red family which is described as Dihydrofolate reductase (PF00186)

PDB Hit:
pdb|1TDR|B Chain B, Molecule: Telluromethionyl Dihydrofolate Re... 142 3e-035
pdb|1RA9| Dihydrofolate Reductase Complexed With Nicotinamid... 141 4e-035
pdb|1DRA|B Chain B, Dihydrofolate Reductase (Dhfr) (E.C.1.5.1.3... 140 1e-034

Gene Protein Sequence:
MFISLIVARTKNHVIGRHNQMPWHLPRDLMWFREKTIDKPIIMGRKTYES
IGRLLPKRPNIILSRTELKIDGAYTATSLAEAIELAKKFTAEEIMVIGGG
ELFKQALPLAQRLYLTEIEADIEGDTYFAFNEQDWQLIRKESSEIDEHNN
YVCHFMQFERI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTATTAGCCTTATTGTGGCGCGTACAAAAAATCACGTGATAGGCCG
CCACAATCAAATGCCTTGGCATTTGCCTCGTGATTTAATGTGGTTTCGCG
AAAAGACCATAGATAAACCGATAATTATGGGACGTAAGACCTATGAGTCT
ATTGGCCGTCTTTTGCCTAAGCGACCCAATATTATTTTATCGCGAACTGA
ATTAAAGATTGATGGGGCTTATACGGCAACCAGCTTAGCCGAAGCGATTG
AATTAGCAAAAAAATTTACAGCTGAAGAAATAATGGTTATTGGTGGAGGA
GAATTATTTAAACAGGCGCTGCCATTAGCCCAAAGACTGTATTTAACGGA
GATTGAAGCTGATATTGAAGGCGATACTTATTTTGCGTTCAATGAACAAG
ATTGGCAATTAATTCGCAAAGAAAGCTCAGAAATAGATGAACATAACAAC
TATGTTTGTCATTTTATGCAATTTGAGCGTATTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy