Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 tRNA-Arg-2 IGR809 IGR811 IGR813 IGR807 IGR814 IGR810 IGR812 IGR808 IGR806 IGR815 IGR805 HD1119 nth, - HD1115 fdoI,fdxI, - HD1111 HD1117 fdhE, - HD1110 sms,radA, - HD1121 HD1120 folA,dyr, - HD1118 fdhD, - HD1113 folD, - HD1108 dapA, - HD1107 HD1109 HD1119 nth, - HD1115 fdoI,fdxI, - HD1111 HD1117 fdhE, - HD1110 sms,radA, - HD1121 HD1120 folA,dyr, - HD1118 fdhD, - HD1113 folD, - HD1108 dapA, - HD1107 HD1109 HD1119 nth, - HD1115 fdoI,fdxI, - HD1111 HD1117 fdhE, - HD1110 sms,radA, - HD1121 fdxH, - HD1112 fdxH, - HD1112 folA,dyr, - HD1118 fdhD, - HD1113 folD, - HD1108 dapA, - HD1107 HD1109 HD1120
* Calculated from Protein Sequence

Gene ID: HD1111

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fdoI  fdxI  

Definition:
formate dehydrogenase, gamma subunit

Gene Start:
887666

Gene Stop:
886977

Gene Length:
690

Molecular Weight*:
26475

pI*:
10.60

Net Charge*:
11.39

EC:
1.2.1.2  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism
Methane metabolism

Secondary Evidence:

Benoit S, Abaibou H, Mandrand-Berthelot MA.
Topological analysis of the aerobic membrane-bound formate dehydrogenase of Escherichia coli.
J Bacteriol. 1998 Dec;180(24):6625-34.
PMID: 9852007



Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to formate dehydrogenase proteins (gamma subunit); e.g., residues 8-222 are 79% similar to FDXI_HAEIN [2507023]; residues 18-223 are 53% similar to FDNI_ECOLI [2507022], and residues 18-214 are 51% similar to FDOI_ECOLI [416986].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 18-214 are 81% similar to a (SUBUNIT FORMATE DEHYDROGENASE GAMMA) protein domain (PD013589) which is seen in FDXI_HAEIN.



Paralogs:  Local Blast Search


HD1111 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKENNMSNKLTITNDTKIVRHKPIARVSHWFLVIAFFLTMFTGVAFFFPD
FAWLTEVLGTPQLARAIHPFTGIVMFIAFIIMALIYWHHNIPEKNDIRWA
KGIVEVLKGNEHAVAYNGKYNLGQKMLFWTLILAMFTLLATGIIMWRKYF
SANFSITTLRVAILLHSVSAFALFSGILVHIYMAFWVKGSITGMVEGWVT
VRWAKKHHPKWFNEEVLPELKEKVNQADQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGGAGAACAACATGAGTAATAAATTAACCATTACTAACGATACCAA
AATCGTTCGACACAAACCTATCGCACGCGTTAGTCATTGGTTCTTAGTTA
TAGCCTTTTTCTTAACTATGTTTACTGGTGTTGCGTTCTTCTTCCCTGAT
TTCGCCTGGCTAACAGAAGTATTAGGTACACCGCAACTAGCTCGAGCTAT
TCACCCTTTCACGGGGATTGTGATGTTCATTGCTTTCATCATTATGGCGC
TGATTTATTGGCATCATAATATTCCTGAAAAAAATGATATCCGTTGGGCA
AAAGGCATTGTTGAAGTGTTAAAAGGTAATGAACATGCGGTGGCTTATAA
TGGCAAATATAACTTAGGTCAAAAAATGTTGTTTTGGACACTCATTTTGG
CAATGTTTACGCTATTAGCAACAGGGATTATTATGTGGAGAAAATACTTC
TCCGCTAACTTCTCCATTACCACCTTACGGGTTGCCATCTTACTGCATTC
TGTAAGTGCATTTGCCTTATTCAGTGGGATCTTAGTGCATATCTATATGG
CATTTTGGGTAAAAGGTTCTATCACTGGTATGGTTGAAGGTTGGGTCACC
GTTCGCTGGGCAAAAAAACATCATCCGAAATGGTTCAATGAAGAAGTTCT
ACCTGAATTGAAAGAAAAAGTAAATCAAGCTGATCAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy