Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 tRNA-Arg-2 IGR809 IGR807 IGR802 IGR810 IGR801 IGR808 IGR804 IGR806 IGR803 IGR805 HD1102 yfiA, - HD1105 nth, - HD1115 fdoI,fdxI, - HD1111 fdhE, - HD1110 folE, - HD1103 fdhD, - HD1113 truA,hisT, - HD1104 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 HD1109 HD1102 yfiA, - HD1105 nth, - HD1115 fdoI,fdxI, - HD1111 fdhE, - HD1110 folE, - HD1103 fdhD, - HD1113 truA,hisT, - HD1104 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 HD1109 HD1102 yfiA, - HD1105 nth, - HD1115 fdoI,fdxI, - HD1111 fdhE, - HD1110 fdxH, - HD1112 fdxH, - HD1112 folE, - HD1103 fdhD, - HD1113 truA,hisT, - HD1104 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 HD1109
* Calculated from Protein Sequence

Gene ID: HD1108

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
folD  

Definition:
5,10-methylenetetrahydrofolate dehydrogenase (bifunctional protein)

Gene Start:
883384

Gene Stop:
884247

Gene Length:
864

Molecular Weight*:
31070

pI*:
7.30

Net Charge*:
1.21

EC:
1.5.1.5  3.5.4.9  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Comment:
For other "fol" genes, see HD0978 (folB), HD1118 (folA), HD1465 (folC), HD0644 (folP).

Blast Summary:  PSI-Blast Search
Numerous strong hits in gapped BLAST to folD bifunctional proteins and related proteins; e.g., residues 1-283 are 66% similar to FOLD_HAEIN [1169725], residues 1-283 are 59% similar to FOLD_ECOLI [2507454], and 1-283 are 59% similar to FOLD_SALTY [2501184].

COGS Summary:  COGS Search
BeTs to 13 clades of COG0190
COG name: 5,10-methylene-tetrahydrofolate dehydrogenase
Functional Class:  H
The phylogenetic pattern of COG0190 is ----Yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000672 (Tetrahydrofolate dehydrogenase/cyclohydrolase) with a combined E-value of 3.2e-131.
    IPB000672A    34-63
    IPB000672B    70-121
    IPB000672C    149-196
    IPB000672D    203-233
    IPB000672E    240-276


ProDom Summary:  Protein Domain Search
Residues 26-280 are 70% similar to a (METHYLENETETRAHYDROFOLATE DEHYDROGENASE CYCLOHYDROLASE) protein domain (PD002300) which is seen in Q9CJR1_PASMU.



Paralogs:  Local Blast Search


HD1108 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 121 (E-value = 2.9e-59) place HD1108 in the THF_DHG_CYH family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763)
Residues 123 to 284 (E-value = 5.6e-102) place HD1108 in the THF_DHG_CYH_C family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882)

PDB Hit:
pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate Dehydroge... 337 1e-093
pdb|1DIA|A Chain A, Human Methylenetetrahydrofolate Dehydrogena... 216 3e-057
pdb|1A4I|B Chain B, Human Tetrahydrofolate Dehydrogenase CYCLO... 216 3e-057

Gene Protein Sequence:
MAAKIISGINIAKQIKQNIAQKIAQYIVNGYRRPGLAVILVGADPASQVY
VNSKRKSCAEIGIESKYYDLPATITEVELLSIIQRLNSDEMIDGILVQLP
LPEHINPIHITEAISSDKDVDGFHPYNVGRLCQKIPTLRSCTSYGVMKLL
ESTHIDLSGLHAVIVGASNIVGRPMAMELLLAGCTVTITHSRTKNLVDHL
SSADIVIVGIGHPNFVKGEWLKQGAIVIDVGINRDTYSKKLVGDVDFLTA
EAKASFITPVPGGVGPMTVAMLMQNTLQAYEHHLQAV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCAAAAATTATTTCAGGCATAAACATTGCTAAACAGATTAAACA
AAATATCGCACAAAAGATAGCGCAGTATATTGTTAATGGATATCGCCGTC
CTGGGCTGGCCGTTATTTTGGTGGGGGCGGATCCCGCTTCTCAAGTTTAT
GTCAACAGTAAACGTAAAAGCTGTGCAGAAATTGGCATTGAATCAAAATA
TTATGACTTGCCAGCTACGATTACTGAAGTCGAACTGTTGTCTATTATTC
AACGATTAAATAGTGATGAAATGATTGACGGTATTTTAGTCCAGCTACCC
TTACCGGAACATATTAATCCTATTCACATTACGGAAGCTATCTCATCAGA
TAAAGATGTTGATGGTTTTCACCCTTATAATGTAGGGCGTTTATGCCAAA
AAATTCCAACGTTACGTTCTTGTACATCGTATGGTGTAATGAAATTATTA
GAAAGCACTCATATTGATTTAAGTGGATTACATGCGGTTATTGTTGGCGC
ATCAAATATTGTTGGGCGACCAATGGCGATGGAGTTATTGTTGGCTGGTT
GTACGGTCACCATTACACACAGTCGAACTAAAAATTTAGTTGATCATCTT
AGCTCGGCAGATATTGTTATAGTTGGTATAGGGCATCCAAATTTTGTAAA
AGGTGAGTGGTTAAAGCAAGGTGCTATCGTGATCGATGTAGGAATTAATC
GAGATACATATTCGAAAAAATTAGTCGGCGATGTAGATTTTTTAACCGCT
GAAGCCAAAGCTAGTTTTATTACGCCAGTACCTGGTGGCGTTGGTCCGAT
GACAGTGGCAATGTTAATGCAAAATACATTACAAGCTTATGAACACCATT
TACAAGCGGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy