Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 tRNA-Arg-2 IGR807 IGR802 IGR800 IGR801 IGR808 IGR804 IGR806 IGR803 IGR805 yfiA, - HD1105 fdoI,fdxI, - HD1111 kdkA, - HD1101 fdhE, - HD1110 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 HD1109 yfiA, - HD1105 fdoI,fdxI, - HD1111 kdkA, - HD1101 fdhE, - HD1110 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 HD1109 yfiA, - HD1105 fdoI,fdxI, - HD1111 kdkA, - HD1101 fdhE, - HD1110 HD1102 HD1102 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 HD1109
* Calculated from Protein Sequence

Gene ID: HD1107

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dapA  

Definition:
dihydrodipicolinate synthase

Gene Start:
882024

Gene Stop:
882917

Gene Length:
894

Molecular Weight*:
31737

pI*:
5.40

Net Charge*:
-7.21

EC:
4.2.1.52  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Lysine biosynthesis

Secondary Evidence:
Motoyama H, Yano H, Terasaki Y, Anazawa H.
Overproduction of L-Lysine from methanol by Methylobacillus glycogenes derivatives carrying a plasmid with a mutated dapA gene.
Appl Environ Microbiol. 2001 Jul;67(7):3064-70.
PMID: 11425723

Garcia-Rodriguez FM, Zekri S, Toro N.
Characterization of the Sinorhizobium meliloti genes encoding a functional dihydrodipicolinate synthase (dapA) and
dihydrodipicolinate reductase (dapB).
Arch Microbiol. 2000 May-Jun;173(5-6):438-44.
PMID: 10896225

Vasicova P, Patek M, Nesvera J, Sahm H, Eikmanns B.
Analysis of the Corynebacterium glutamicum dapA promoter.
J Bacteriol. 1999 Oct;181(19):6188-91.
PMID: 10498736

Comment:
For other "dap" genes, see HD1398 (dapB), HD0026 (dapF), HD0630 (dapD), HD0642 (dapE).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to dapA proteins; e.g., residues 7-297 are 70% similar to DAPA_HAEIN; residues 7-297 are 50% similar to DAPA_ECOLI; and residues 7-295 are 47% similar to the gene for dihydrodipicolinate synthase (AE002444) in Neisseria meningitidis MC58.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0329
COG name: Dihydrodipicolinate synthetase/N-acetylneuraminate lyase
Functional Class: E,M
The phylogenetic pattern of COG0329 is amtk-qvcEBrHuj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002220 (Dihydrodipicolinate synthetase) with a combined E-value of 1.7e-70.
    IPB002220A    14-26
    IPB002220B    40-61
    IPB002220C    80-127
    IPB002220D    134-145
    IPB002220E    184-198
    IPB002220F    203-216
    IPB002220G    241-265


ProDom Summary:  Protein Domain Search
Residues 15-95 are 68% similar to a (SYNTHASE DIHYDRODIPICOLINATE LYASE BIOSYNTHESIS) protein domain (PD001859) which is seen in DAPA_HAEIN.

Residues 108-291 are 75% similar to a (SYNTHASE DIHYDRODIPICOLINATE LYASE BIOSYNTHESIS PROTEOME) protein domain (PD213669) which is seen in Q9CLZ7_PASMU.

Residues 23-104 are 42% similar to a (HYDRATASE-ALDOLASE PYRUVATE PLASMID) protein domain (PD367468) which is seen in Q9KC32_BACHD.



Paralogs:  Local Blast Search
HD1107 is paralogously related to HD1850 (2e-19).


Pfam Summary:  Pfam Search
Residues 7 to 295 (E-value = 9.2e-149) place HD1107 in the DHDPS family which is described as Dihydrodipicolinate synthetase family (PF00701)

PDB Hit:
pdb|1DHP|A Chain A, Dihydrodipicolinate Synthase >gi|1942362|pd... 372 3e-104
pdb|1NAL|1 Chain 1, Mol_id: 1; Molecule: N-Acetylneuraminate Ly... 105 6e-024
pdb|1FDZ|A Chain A, N-Acetylneuraminate Lyase In Complex With P... 102 4e-023

Gene Protein Sequence:
MIMSVPLFHGSIVALLTPMTHGEVNYQEIKNLVEYHIQAGSHGIVAMGTT
GESTTLSIDEHVKVIKKTVEFADGRIPIIAGSGSNATSEAVTITKLLNGV
GVVGCLSVVPYYNKPTQEGLYLHYKAIAESTELPQILYNVPSRTGCDLKP
ETIGRLSEIPNIIGVKEATGDLTRLPLIKTLAGEDFIFLSGDDATGLESM
KLGGQGVISVTNNLAAADMAKMCELVLAGNFAEAEAINQRLIDLHHDLFI
EANPIPVKWAAYKLGLISEPSLRLPLTPLSETAQPTILKALQKAGLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATGTCCGTCCCACTCTTTCACGGCAGTATTGTTGCTTTATTAAC
GCCGATGACGCATGGCGAAGTTAATTACCAAGAGATAAAAAATTTAGTTG
AATATCATATTCAAGCGGGTTCACATGGCATTGTGGCAATGGGGACGACC
GGTGAATCTACAACCCTCAGTATTGATGAACACGTGAAAGTAATTAAGAA
AACCGTAGAGTTTGCTGATGGAAGAATTCCCATTATTGCTGGTTCCGGCT
CAAATGCAACGAGTGAAGCGGTAACCATTACTAAATTATTGAATGGTGTT
GGCGTTGTGGGCTGTCTAAGTGTTGTGCCGTATTATAATAAACCTACTCA
AGAAGGATTATATTTACATTATAAAGCGATTGCCGAAAGCACCGAACTAC
CTCAAATTTTATATAATGTGCCAAGTCGAACAGGCTGTGATTTAAAACCC
GAAACAATCGGGCGTTTGTCAGAAATTCCTAATATTATCGGGGTAAAGGA
AGCGACAGGCGATTTAACTCGCTTGCCTTTAATTAAAACATTAGCGGGCG
AAGATTTCATTTTTTTAAGTGGTGATGATGCCACTGGCTTAGAGTCAATG
AAATTAGGCGGACAAGGTGTAATATCGGTGACTAATAATCTGGCAGCAGC
GGATATGGCTAAAATGTGTGAATTAGTTTTAGCAGGCAATTTTGCTGAAG
CAGAAGCAATTAATCAACGTTTGATTGATTTACATCACGATTTATTTATT
GAAGCAAATCCAATCCCAGTAAAATGGGCGGCTTATAAATTAGGGTTGAT
TAGTGAGCCTAGCTTACGCTTGCCGCTTACACCACTTTCTGAAACCGCAC
AACCCACTATATTAAAAGCGCTACAAAAAGCAGGTTTAATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy