Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 tRNA-Arg-2 IGR807 IGR799 IGR802 IGR800 IGR801 IGR804 IGR806 IGR803 IGR805 yfiA, - HD1105 kdkA, - HD1101 fdhE, - HD1110 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1109 yfiA, - HD1105 kdkA, - HD1101 fdhE, - HD1110 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1109 yfiA, - HD1105 kdkA, - HD1101 fdhE, - HD1110 HD1102 HD1102 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 HD1109 metI, - HD1099 metN, - HD1098 metI, - HD1099
* Calculated from Protein Sequence

Gene ID: HD1106

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
htrB  

Definition:
lipid A biosynthesis lauroyl acyltransferase

Gene Start:
880954

Gene Stop:
881910

Gene Length:
957

Molecular Weight*:
36622

pI*:
10.60

Net Charge*:
17.74

EC:
2.3.1.-  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Glycerolipid metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
Karow,M. and Georgopoulos,C.
Sequencing, mutational analysis, and transcriptional regulation of
the Escherichia coli htrB gene
Molecular microbiology. 5 (9), 2285-2292 (1991)
Medline: 92114808

Karow,M., Fayet,O., Cegielska,A., Ziegelhoffer,T. and
Georgopoulos,C.
Isolation and characterization of the Escherichia coli htrB gene,whose product is essential for bacterial viability above 33 degrees C in rich media
Journal of bacteriology. 173 (2), 741-750 (1991)
Medline: 91100364

Lee,N.G., Sunshine,M.G., Engstrom,J.J., Gibson,B.W. and
Apicella,M.A.
Mutation of the htrB locus of Haemophilus influenzae nontypable
strain 2019 is associated with modifications of lipid A and
phosphorylation of the lipo-oligosaccharide
J. Biol. Chem. 270 (45), 27151-27159 (1995)
Medline: 96070820




Comment:
This protein acylates the intermediate (KDO)2-lipid IVA to form (KDO)2-((LAUROYL)-LIPID IVA.It has 10 fold selectivity for lauroyl-ACP over myristoyl-ACP.



Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 6979888 in GenBank.

Numerous significant hits in gapped BLAST to htrB and msbB lipid A biosynthesis lauroyl acyltransferases and to heat shock protein B; e.g., residues 2-318 are 100% similar to HtrB [6979888|], residues 143-309 are 54% similar to HTRB_ECOLI [123731], and residues 16-309 are 45% similar to the sequence for a cold shock-induced palmitoleoyl transferase in E. coli [1872207].

COGS Summary:  COGS Search
BeTs to 4 clades of COG1560
COG name: Lauroyl/myristoyl acyltransferase involved in lipid A biosynthesis
Functional Class:  N
The phylogenetic pattern of COG1560 is --------E-rHuj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 29-103 are identical to a (ACYLTRANSFERASE BIOSYNTHESIS LIPID COMPLETE PROTEOME) protein domain (PD191353) which is seen in Q9L7Q3_HAEDU.

Residues 104-150 are identical to a (ACYLTRANSFERASE BIOSYNTHESIS HEAT SHOCK) protein domain (PD402719) which is seen in Q9L7Q3_HAEDU.

Residues 159-318 are identical to a (ACYLTRANSFERASE COMPLETE PROTEOME BIOSYNTHESIS LIPID) protein domain (PD011612) which is seen in Q9L7Q3_HAEDU.



Paralogs:  Local Blast Search
HD1106 is paralogously related to HD0404 (6e-34).


Pfam Summary:  Pfam Search
Residues 13 to 307 (E-value = 4.5e-123) place HD1106 in the Lip_A_acyltrans family which is described as Bacterial lipid A biosynthesis acyltransferase (PF03279)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LMGDKKMSKDNKNPAFEWRFLLPKYWGLWIGFAIFKLILCLPYPILVKIG
RSLAKLFSTLSFGKRRIAVARRNLALCFPDYSAEQIEAILIKNVESVGMA
IIETGMAWFWSDKRILKWSNIEGLEHLQQPKGTGILFVGVHFLTLELGAR
IVGLHHQGIGVYRPNDNPLLNWIQFKGRIRSNKAMLDRKDLRGMIRALRD
GETIWYAPDHDYGQQNSVFVPFFAVEQACTTAGSHMLLRSAPNSIVVPFT
PIRHYDFSGYTVKISPAVDFNDCQNKIETARLMNKVVETEILKAQTQYMW
LHRRFKTRPNQSAENLYR$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATGGGTGATAAAAAAATGAGTAAAGATAATAAAAATCCTGCATTTGA
ATGGCGTTTTTTATTGCCAAAGTATTGGGGACTATGGATTGGGTTCGCTA
TATTTAAACTAATTTTATGTTTACCTTATCCAATCCTTGTAAAAATAGGT
CGTTCACTGGCTAAGCTTTTTTCAACGTTAAGTTTTGGTAAGCGGAGGAT
TGCGGTTGCTCGACGCAATTTAGCATTATGTTTTCCTGATTATTCAGCTG
AACAGATAGAAGCTATTTTAATCAAGAATGTTGAATCAGTTGGTATGGCG
ATTATTGAAACGGGGATGGCATGGTTTTGGTCAGATAAACGTATTTTAAA
ATGGTCTAATATTGAAGGACTAGAACATCTACAACAGCCAAAAGGTACAG
GTATTTTATTTGTTGGGGTACATTTTTTAACGCTAGAATTAGGTGCACGT
ATTGTTGGTTTACATCATCAAGGTATTGGTGTTTATCGCCCAAATGATAA
TCCGCTATTAAACTGGATTCAGTTTAAAGGGCGCATACGTTCTAATAAGG
CTATGCTTGATAGAAAAGATTTACGCGGTATGATTCGTGCTTTAAGAGAC
GGTGAAACGATTTGGTATGCACCTGATCACGACTATGGCCAACAAAATAG
TGTTTTTGTACCATTTTTTGCGGTTGAACAAGCTTGTACGACTGCTGGTT
CGCATATGTTATTACGTTCTGCGCCAAATAGTATTGTGGTACCATTTACG
CCTATTCGTCACTATGATTTTTCAGGTTATACAGTAAAAATCAGTCCTGC
GGTTGATTTCAATGATTGTCAAAATAAGATCGAAACCGCTCGCTTAATGA
ATAAAGTAGTTGAAACTGAAATTTTAAAAGCGCAAACTCAATATATGTGG
TTACATCGCCGTTTTAAAACTCGCCCAAACCAGTCGGCTGAAAATTTATA
TCGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy