Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 tRNA-Arg-2 IGR799 IGR802 IGR797 IGR800 IGR801 IGR804 IGR798 IGR806 IGR803 IGR805 HD1097 yfiA, - HD1105 HD1096 kdkA, - HD1101 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1109 HD1097 yfiA, - HD1105 HD1096 kdkA, - HD1101 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1109 yfiA, - HD1105 HD1096 kdkA, - HD1101 HD1102 HD1102 HD1097 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1109 metI, - HD1099 metI, - HD1099
* Calculated from Protein Sequence

Gene ID: HD1104

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
truA  hisT  

Definition:
pseudouridylate synthase I (truA)

Gene Start:
879646

Gene Stop:
880431

Gene Length:
786

Molecular Weight*:
29447

pI*:
9.20

Net Charge*:
6.74

EC:
4.2.1.70  5.4.99.12  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Kammen,H.O., Marvel,C.C., Hardy,L. and Penhoet,E.E.
Purification, structure, and properties of Escherichia coli tRNA
pseudouridine synthase I
J. Biol. Chem. 263 (5), 2255-2263 (1988)
Medline: 88115366

Huang,L., Pookanjanatavip,M., Gu,X. and Santi,D.V.
A conserved aspartate of tRNA pseudouridine synthase is essential
for activity and a probable nucleophilic catalyst
Biochemistry 37 (1), 344-351 (1998)
Medline: 98087694


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to tRNA-pseudouridine synthases; e.g., residues 1-261 are 73% similar to TRUA_HAEIN [1174804], residues 2-261 are 67% similar to TRUA_ECOLI [123176], residues 4-249 are 46% similar to the sequence for tRNA pseudouridine synthase A in Neisseria meningitidis MC58 [7227297].

COGS Summary:  COGS Search
BeTs to 17 clades of COG0101
COG name: Pseudouridylate synthase (tRNA psi55)
Functional Class: J
The phylogenetic pattern of COG0101 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001406 (tRNA pseudouridine synthase) with a combined E-value of 2.9e-65.
    IPB001406A    2-30
    IPB001406B    47-63
    IPB001406C    82-113
    IPB001406D    146-157
    IPB001406E    187-202
    IPB001406F    229-238


ProDom Summary:  Protein Domain Search
Residues 30-244 are 51% similar to a (SYNTHASE PSEUDOURIDINE TRNA) protein domain (PD180648) which is seen in Q9PDK6_XYLFA.

Residues 1-243 are 74% similar to a (SYNTHASE TRNA PSEUDOURIDINE) protein domain (PD003202) which is seen in TRUA_HAEIN.



Paralogs:  Local Blast Search


HD1104 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 103 (E-value = 2.2e-37) place HD1104 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)
Residues 142 to 244 (E-value = 2.1e-34) place HD1104 in the PseudoU_synth_1 family which is described as tRNA pseudouridine synthase (PF01416)

PDB Hit:
pdb|1DJ0|A Chain A, The Crystal Structure Of E. Coli Pseudourid... 371 6e-104
pdb|1DJ0|A Chain A, The Crystal Structure Of E. Coli Pseudourid... 503 1e-143

Gene Protein Sequence:
MKVALGIEYDGSNYFGWQRQAEVVSVQQTLEEALSKVTNTTIEVFCAGRT
DSGVHGTGQVVHFDTEVERPLASWCFGTNAHLANDIAVKWAVKVAEDFHA
RFSATARRYRYIIFNSKLRTAILPKGVAHYHYPLDAQKMHQAGQYLLGEQ
DFSSFRAAKCQSHTPWRNIHHLNVVRQGNYVIVDIQANAFVHHMVRNIVG
SLLEVGQGRQPIEWIKWLLEQKNRQLAAPTTKAEGLYLVNVEYPSRFGIP
KTALGPLFLAD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTGCATTAGGCATTGAATATGACGGTAGCAATTATTTTGGTTG
GCAACGCCAAGCAGAAGTTGTCAGTGTTCAACAAACTTTAGAAGAAGCGT
TATCAAAAGTGACAAATACCACTATTGAAGTATTCTGTGCCGGACGAACT
GATTCTGGCGTGCACGGTACAGGGCAAGTTGTGCACTTTGATACGGAAGT
TGAGCGCCCATTAGCAAGTTGGTGTTTTGGAACTAATGCACATTTAGCTA
ATGATATTGCCGTCAAATGGGCAGTAAAGGTGGCGGAGGATTTCCATGCA
CGTTTTAGTGCAACTGCACGCCGTTATCGTTATATTATTTTCAACAGTAA
ATTACGGACAGCCATCTTGCCTAAAGGTGTTGCTCATTATCATTACCCTC
TAGATGCACAGAAAATGCATCAAGCAGGACAATACTTATTAGGTGAACAA
GATTTTTCATCTTTTCGTGCAGCGAAATGCCAATCGCATACACCCTGGCG
GAATATTCATCATTTGAATGTAGTAAGACAAGGGAATTATGTGATTGTAG
ATATTCAAGCAAATGCGTTTGTACATCATATGGTACGAAATATTGTTGGT
AGTTTATTAGAAGTCGGGCAAGGACGTCAGCCTATTGAATGGATAAAATG
GCTACTTGAACAAAAAAACCGTCAATTAGCTGCACCAACTACGAAAGCAG
AAGGGCTATATTTAGTCAATGTAGAGTACCCAAGTCGTTTTGGTATTCCT
AAAACCGCATTAGGACCATTATTTTTGGCAGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy