Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 tRNA-Arg-2 IGR799 IGR802 IGR797 IGR800 IGR801 IGR804 IGR798 IGR803 IGR796 IGR805 HD1097 yfiA, - HD1105 HD1096 kdkA, - HD1101 HD1095 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1097 yfiA, - HD1105 HD1096 kdkA, - HD1101 HD1095 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 yfiA, - HD1105 HD1096 kdkA, - HD1101 HD1102 HD1102 HD1097 HD1095 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 metI, - HD1099 metI, - HD1099
* Calculated from Protein Sequence

Gene ID: HD1103

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
folE  

Definition:
GTP cyclohydrolase I

Gene Start:
878891

Gene Stop:
879547

Gene Length:
657

Molecular Weight*:
25035

pI*:
6.80

Net Charge*:
-0.69

EC:
3.5.4.16  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Katzenmeier,G., Schmid,C., Kellermann,J., Lottspeich,F. and
Bacher,A.
Biosynthesis of tetrahydrofolate. Sequence of GTP cyclohydrolase I
from Escherichia coli
Biol. Chem. Hoppe-Seyler 372 (11), 991-997 (1991)
MEDLINE: 92172284

Schmid,C., Meining,W., Weinkauf,S., Bachmann,L., Ritz,H.,
Eberhardt,S., Gimbel,W., Werner,T., Lahm,H.W., Nar,H. and Bacher,A.
Studies on GTP cyclohydrolase I of Escherichia coli
Adv. Exp. Med. Biol. 338, 157-162 (1993)
MEDLINE: 94136208

Schoedon,G., Redweik,U., Frank,G., Cotton,R.G. and Blau,N.
Allosteric characteristics of GTP cyclohydrolase I from Escherichia coli
Eur. J. Biochem. 210 (2), 561-568 (1992)
MEDLINE: 93092993

Nar,H., Huber,R., Meining,W., Schmid,C., Weinkauf,S. and Bacher,A.
Atomic structure of GTP cyclohydrolase I
Structure 3 (5), 459-466 (1995)
MEDLINE: 95393017



Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to GTP cyclohydrolase I proteins; e.g., residues 1-218 are 76% similar to to GCH1_HAEIN [1169876], residues 1-216 are 62% similar to GCH1_ECOLI [585192], and residues 31-218 are 42% similar to GCH1_BACSU [127481].

COGS Summary:  COGS Search
BeTs to 8 clades of COG0302
COG name: GTP cyclohydrolase I
Functional Class:  H
The phylogenetic pattern of COG0302 is ----yq-cebrhuJ------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001474 (GTP cyclohydrolase I) with a combined E-value of 1.3e-51.
    IPB001474A    49-66
    IPB001474B    94-146
    IPB001474C    165-185


ProDom Summary:  Protein Domain Search
Residues 38-218 are 87% similar to a (GTP CYCLOHYDROLASE I GTP-CH-I) protein domain (PD003330) which is seen in GCH1_PASMU.



Paralogs:  Local Blast Search


HD1103 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 96 to 200 (E-value = 8e-51) place HD1103 in the GTP_cyclohydroI family which is described as GTP cyclohydrolase I (PF01227)

PDB Hit:
pdb|1GTP|A Chain A, Gtp Cyclohydrolase I >gi|1943378|pdb|1GTP|B... 272 2e-074
pdb|1A8R|A Chain A, Gtp Cyclohydrolase I (H112s Mutant) In Comp... 269 2e-073
pdb|1A9C|A Chain A, Gtp Cyclohydrolase I (C110s Mutant) In Comp... 268 3e-073

Gene Protein Sequence:
MSIISSEAQKVRQALIKKGIETPTIELTQDKDSRRAEIQQHMRSVLELLG
LDLRDDSLEETPHRLAKMYVDEIFSGLDYATFPKITTIENRMKVSEMVLV
DDITLTSTCEHHFVTIDGKVAVAYYPKKWVIGLSKINRVVQFFAQRPQVQ
ERFTEQILTAFQTILETEDVAIYVKATHFCVKCRGIKDSNSYTVTSAFGG
VFLDDRETRKEFLNLIHK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCATTATCTCAAGCGAAGCCCAAAAAGTGCGTCAAGCGTTGATTAA
AAAGGGTATCGAAACGCCAACAATTGAGTTAACACAAGATAAAGATTCAC
GACGAGCTGAAATTCAACAACATATGCGTTCAGTATTAGAATTGCTTGGC
CTAGATTTACGTGATGATAGTTTAGAAGAAACCCCGCATCGTTTAGCAAA
AATGTATGTAGATGAAATCTTTAGCGGGTTAGATTACGCGACTTTTCCTA
AAATTACCACGATTGAAAATCGTATGAAAGTGAGCGAAATGGTATTAGTT
GATGATATTACATTGACTTCAACTTGTGAACACCATTTTGTGACGATCGA
TGGCAAAGTAGCGGTTGCTTATTATCCGAAAAAATGGGTGATTGGCTTAT
CGAAAATTAACCGAGTAGTACAATTTTTTGCTCAACGTCCACAAGTGCAA
GAACGTTTTACTGAGCAGATTTTAACCGCATTTCAAACTATTTTAGAAAC
CGAAGATGTTGCAATCTATGTCAAAGCAACGCATTTTTGTGTTAAGTGTC
GCGGCATAAAGGATAGCAATAGTTATACAGTGACTTCTGCATTTGGTGGT
GTGTTTTTAGATGATCGTGAAACACGTAAAGAGTTTTTAAACCTAATTCA
CAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy