Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 tRNA-Arg-2 IGR795 IGR799 IGR802 IGR797 IGR800 IGR801 IGR804 IGR798 IGR803 IGR796 IGR805 HD1097 yfiA, - HD1105 HD1096 kdkA, - HD1101 HD1095 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1094 HD1097 yfiA, - HD1105 HD1096 kdkA, - HD1101 HD1095 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1094 yfiA, - HD1105 HD1096 kdkA, - HD1101 HD1102 HD1102 HD1097 HD1095 folE, - HD1103 truA,hisT, - HD1104 hlpA, - HD1100 folD, - HD1108 dapA, - HD1107 htrB, - HD1106 metN, - HD1098 HD1094 metI, - HD1099 metI, - HD1099
* Calculated from Protein Sequence

Gene ID: HD1101

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
kdkA  

Definition:
probable KDO kinase

Gene Start:
878783

Gene Stop:
878055

Gene Length:
729

Molecular Weight*:
28734

pI*:
10.20

Net Charge*:
9.79

EC:
 

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Secondary Evidence:
Brabetz W, Muller-Loennies S, Brade H.
3-Deoxy-D-manno-oct-2-ulosonic acid (Kdo) transferase (WaaA) and kdo kinase (KdkA) of Haemophilus influenzae are both
required to complement a waaA knockout mutation of Escherichia coli.
J Biol Chem. 2000 Nov 10;275(45):34954-62.
PMID: 10952982

White KA, Lin S, Cotter RJ, Raetz CR.
A Haemophilus influenzae gene that encodes a membrane bound 3-deoxy-D-manno-octulosonic acid (Kdo) kinase. Possible
involvement of kdo phosphorylation in bacterial virulence.
J Biol Chem. 1999 Oct 29;274(44):31391-400.
PMID: 10531340

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to H. influenzae hypothetical protein HI0260.1: residues 23-235 are 51% similar to Y26A_HAEIN [6831714].

COGS Summary:  COGS Search
BeTs to 6 clades of COG0515
COG name: Serine/threonine protein kinases
Functional Class: T
The phylogenetic pattern of COG0515 is amtkYq-C-BR---gp-lIN-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000095 (PAK-box /P21-Rho-binding) with a combined E-value of 1.6e-06.
    IPB000095E    159-204


ProDom Summary:  Protein Domain Search
Residues 25-233 are 50% similar to a (PROTEOME COMPLETE KINASE TRANSFERASE) protein domain (PD180638) which is seen in Q9CLD5_PASMU.



Paralogs:  Local Blast Search
HD1101 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 27 to 233 (E-value = 5.7e-78) place HD1101 in the Kdo family which is described as Lipopolysaccharide kinase (Kdo/WaaP) family (PF06293)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPMIHYIFNREIVPPAIEPLLKQLFSGQNFTQSDRLLGYSKGRGITWFLN
TQAELGINIVLRHYYRGGLFGKVVKDRYLFQRIDQTRAVQEFNLLTQMQR
WHLPVPRPIAVEINKQSIFYRAKIMLEKIEHTQDLSKLLQTQPLVAEQYQ
QLGQLIRQLHDHQIHHSDLNIHNILLDDNGKFWLIDFDKCCIKAGEEWKQ
ANLNRLLRSFHKEQTRLGIQFHQQNWQSLLTGYQQHNQGDNR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTATGATTCATTATATTTTTAATCGTGAGATTGTACCCCCCGCTAT
CGAACCACTACTTAAACAACTATTTAGCGGTCAAAATTTTACACAATCCG
ACCGCTTACTAGGCTACAGTAAGGGACGTGGCATTACTTGGTTTTTAAAT
ACGCAAGCAGAACTCGGCATTAATATTGTGCTTCGCCATTATTATCGTGG
TGGCTTATTTGGTAAAGTAGTCAAAGATCGCTATCTTTTTCAGCGCATTG
ATCAAACAAGAGCCGTGCAAGAATTTAACCTATTAACCCAAATGCAACGT
TGGCATTTACCCGTACCTCGCCCAATTGCGGTTGAAATCAATAAACAATC
CATTTTCTATCGTGCCAAAATTATGTTAGAAAAAATTGAACATACTCAAG
ATCTGAGTAAATTGTTACAAACACAACCGCTTGTTGCAGAACAATACCAA
CAACTTGGCCAATTGATCCGTCAATTGCATGACCACCAAATACATCATTC
TGATTTAAATATTCACAATATTTTGCTTGATGATAACGGCAAATTTTGGT
TAATTGATTTTGATAAATGTTGTATTAAAGCCGGCGAAGAATGGAAACAA
GCCAATTTAAACCGCTTATTGCGTTCATTCCATAAAGAGCAAACTCGATT
AGGTATCCAATTCCATCAGCAGAACTGGCAATCACTGTTAACAGGCTATC
AGCAACATAATCAAGGAGATAACCGGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy