Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR791 IGR795 IGR799 IGR797 IGR794 IGR792 IGR798 IGR793 IGR796 HD1097 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1095 hlpA, - HD1100 metN, - HD1098 cysS, - HD1093 HD1094 HD1097 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1095 hlpA, - HD1100 metN, - HD1098 cysS, - HD1093 HD1094 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1097 HD1095 hlpA, - HD1100 metN, - HD1098 cysS, - HD1093 HD1094 metI, - HD1099 metI, - HD1099
* Calculated from Protein Sequence

Gene ID: HD1094

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
outer membrane peptidase

Gene Start:
871817

Gene Stop:
874129

Gene Length:
2313

Molecular Weight*:
83488

pI*:
9.10

Net Charge*:
8.76

EC:
3.4.21.-  

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several moderate hits in gapped BLAST to outer-membrane proteases and serotype-specific antigens; e.g., residues 160-687 are 24% similar to residues 267-853 of a protein in Neisseria meningitidis described as a putative outer membrane peptidase [7379224], a putative serotype-1-specific antigen [7227230], and an autotransporter serine protease [7649690]. In addition, residues 145-526 are 24% similar to residues 207-571 of SSA1_PASHA, serotype-1 specific antigen in Pasteurella haemolytica.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1404
COG name: Subtilisin-like serine proteases
Functional Class: O
The phylogenetic pattern of COG1404 is A---Yq-c-BR----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000209 (Serine proteases, subtilase family) with a combined E-value of 2e-10.
    IPB000209A    68-80
    IPB000209D    205-214
    IPB000209E    285-295


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD1094 is paralogously related to HD1280 (7e-14).


Pfam Summary:  Pfam Search
Residues 50 to 335 (E-value = 1.1e-06) place HD1094 in the Peptidase_S8 family which is described as Subtilase family (PF00082)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKENEFILLKFTQMKRQYKIITLATTTALISACGGSSGGDDVTHSQNIAR
GYSRYKAASVQDKERAQGQGVYVGLVDTGIDLNSKGLANRKHNISKYVIK
DNTKEISRDDHGHGTLMVELILETAPSASINSAINSGKDGVYSISGLTNL
LRANQVGVKVDIVNNSYGVDVKSNEPSEVYGTAPDYTKIRNHDEIKLFKE
FIDRGALVIISTGNEDKLLAQRLAAAPLVDSELKDSFIAVTSLNRQTDQK
DRNACGELAKDWCLTAPENFIGAYGLNNNKMLVPGTSAATAYVSGLAAKI
KSRYDWFTGKDLAQTLFTTTHNKGRKSNDKVWGRGLINENSAMNGYGSFE
KDVILNVEGKKDIYYFDNDISGKGSLTKSGSKVLVMNGNNTYRGSTLVEK
GELVANGNSNSYHIVSKGAKLTIGDSAESIWLDAVQNKGELFVEDANLTV
RRDFDSQNGTVNQAIGTQIQITGSANLKDSSWVLTGVKDGYVTKEGEKEV
LLTANGGITNHSNFKFSYKNGIYSDLVSQTESFDGDTLSVITKRDSLDKV
VHNRHNFTGKDNTVDSLDGLLDRLDVAKLPTNITFHYKKTSKASPLMGLG
IANALLYSKNLNQTVFGMNTATAQHAQLHLVNEKVLRSEKAIDHALSAEQ
SGAIWMDTGFGKTTAKALSSVNGESQDNSQTVGLAKSFSNRQHRLAVQLS
RVDYGWTESYQGLKKALNTHGYGFEAAYAYAPTLNSYWVSGLVGFDRLKA
TSTYGADAGGQLVVGSAVGK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAGAATGAATTTATTTTACTTAAATTTACGCAAATGAAAAGACA
ATACAAAATTATCACATTAGCCACAACAACAGCATTGATCTCTGCATGCG
GTGGAAGCAGCGGTGGGGACGATGTAACGCATTCGCAAAACATAGCCAGG
GGTTATAGTCGATACAAAGCTGCTTCTGTTCAAGATAAAGAACGAGCACA
AGGACAGGGTGTTTACGTTGGTTTGGTCGATACAGGTATTGACTTAAATA
GTAAAGGCTTAGCTAATCGTAAGCATAATATTAGTAAATATGTGATCAAA
GACAATACCAAAGAAATAAGCAGAGATGATCACGGGCACGGTACACTTAT
GGTGGAATTAATTCTGGAAACTGCACCTAGTGCATCTATTAACTCAGCGA
TTAATTCAGGTAAAGATGGCGTCTATAGTATTTCAGGTTTAACAAACTTA
CTTAGAGCCAATCAAGTTGGCGTGAAAGTTGATATTGTAAATAATTCATA
TGGTGTAGATGTTAAATCAAACGAGCCGTCTGAAGTTTACGGTACAGCTC
CAGATTATACAAAAATCAGAAACCACGATGAAATTAAGCTCTTTAAAGAA
TTTATAGACAGAGGTGCATTAGTGATTATTAGTACGGGCAACGAGGATAA
ATTGCTTGCACAAAGATTAGCTGCAGCTCCCTTGGTTGATTCTGAATTGA
AAGATAGTTTTATTGCTGTGACATCTCTCAATCGCCAAACTGATCAAAAA
GATCGAAATGCTTGTGGTGAATTAGCAAAAGATTGGTGTTTGACTGCCCC
TGAAAATTTTATTGGGGCATACGGTTTAAATAACAACAAAATGCTTGTAC
CAGGTACGTCAGCCGCAACTGCTTACGTCAGTGGTTTGGCTGCAAAAATC
AAAAGTCGCTATGATTGGTTCACTGGAAAAGACTTGGCACAAACTTTATT
TACTACGACTCATAATAAAGGCAGAAAAAGCAATGATAAAGTCTGGGGAA
GGGGTTTAATCAATGAAAATTCTGCGATGAATGGTTACGGGAGTTTTGAG
AAAGATGTTATATTAAACGTTGAAGGTAAGAAGGATATTTATTACTTTGA
TAATGATATTTCAGGGAAAGGAAGCCTAACCAAATCAGGTAGTAAGGTTC
TTGTTATGAATGGTAACAATACCTACAGAGGCTCAACCCTTGTTGAAAAG
GGAGAATTGGTTGCAAATGGTAATTCCAATTCTTACCATATTGTTTCAAA
GGGTGCAAAGTTGACTATTGGTGACAGTGCAGAATCTATTTGGTTAGATG
CGGTGCAAAATAAAGGTGAATTGTTCGTAGAAGATGCTAATTTGACTGTA
AGGAGAGATTTTGATAGCCAAAATGGCACGGTTAATCAAGCGATTGGTAC
ACAGATTCAAATCACAGGTTCAGCGAATTTGAAAGATAGCTCATGGGTTT
TAACTGGTGTGAAAGATGGTTATGTTACTAAAGAAGGAGAAAAAGAAGTT
TTATTAACTGCTAATGGAGGAATTACAAACCATTCTAATTTTAAATTCAG
TTATAAAAATGGTATTTATTCAGATCTAGTTAGCCAAACAGAAAGTTTTG
ATGGCGATACTTTGAGTGTTATCACTAAACGTGATAGCCTAGATAAAGTA
GTTCACAATAGGCATAATTTTACAGGTAAAGATAACACCGTTGATTCATT
AGACGGTTTGTTAGATCGTTTAGATGTTGCTAAATTGCCTACAAATATTA
CTTTTCATTACAAAAAAACAAGTAAAGCTAGCCCGCTAATGGGTTTAGGT
ATTGCAAATGCGCTACTGTATTCTAAAAACTTGAACCAAACGGTATTTGG
CATGAATACAGCAACTGCTCAACATGCTCAATTACACCTAGTTAATGAAA
AAGTGTTGCGTAGTGAAAAAGCGATAGACCACGCATTAAGCGCAGAGCAA
TCAGGTGCTATATGGATGGACACAGGTTTTGGCAAAACAACAGCGAAAGC
ATTGTCTAGTGTCAATGGCGAAAGCCAAGACAACTCTCAAACTGTAGGGT
TGGCTAAATCATTTAGTAATAGACAACACCGTTTAGCGGTTCAATTAAGT
CGAGTAGATTACGGCTGGACTGAAAGCTATCAAGGATTGAAAAAAGCACT
TAATACTCATGGTTATGGTTTTGAAGCAGCTTACGCTTATGCGCCTACAC
TTAATAGCTATTGGGTAAGTGGTCTTGTTGGTTTTGACCGCCTAAAAGCA
ACCTCAACTTACGGCGCTGATGCAGGCGGTCAGCTTGTTGTAGGCAGCGC
TGTTGGTAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy