Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR788 IGR791 IGR795 IGR790 IGR789 IGR797 IGR794 IGR792 IGR798 IGR793 IGR796 HD1097 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1089 fdx, - HD1088 HD1095 metN, - HD1098 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 HD1097 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1089 fdx, - HD1088 HD1095 metN, - HD1098 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1097 fdx, - HD1088 HD1095 metN, - HD1098 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 HD1089
* Calculated from Protein Sequence

Gene ID: HD1093

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cysS  

Definition:
cysteinyl-tRNA synthetase

Gene Start:
870349

Gene Stop:
871728

Gene Length:
1380

Molecular Weight*:
52045

pI*:
5.80

Net Charge*:
-9.97

EC:
6.1.1.16  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Cysteine metabolism

Secondary Evidence:
Eriani,G., Dirheimer,G. and Gangloff,J.
Cysteinyl-tRNA synthetase: determination of the last E. coli
aminoacyl-tRNA synthetase primary structure
Nucleic Acids Res. 19 (2), 265-269 (1991)
Medline: 91195046

Hou,Y.M., Shiba,K., Mottes,C. and Schimmel,P.
Sequence determination and modeling of structural motifs for the
smallest monomeric aminoacyl-tRNA synthetase
Proc. Natl. Acad. Sci. U.S.A. 88 (3), 976-980 (1991)
Medline: 91126117



Comment:
For other "cys" genes, see HD1030 (cysB), HD0659 (cysE), HD0832 (cysZ), HD0840 (cysQ), HD0896 (cysK).

Blast Summary:  PSI-Blast Search
Many strong hits in gapped BLAST to cysteinyl-tRNA synthetases (cysteine tRNA ligases); e.g., residues 1-458 are 72% similar to SYC_HAEIN [1174501], residues 1-468 are 68% similar to SYC_ECOLI [135097], and residues 1-458 are 55% similar to the sequence for cysteinyl-tRNA synthetase in Neisseria meningitidis MC58 [7227346].

COGS Summary:  COGS Search
BeTs to 15 clades of COG0215
COG name: Cysteinyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0215 is a--kyqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 342-457 are 46% similar to a (LIGASE SYNTHETASE CYSTEINYL-TRNA) protein domain (PD006340) which is seen in SYC_BUCAI.

Residues 258-321 are 71% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000476) which is seen in SYC_PASMU.

Residues 346-458 are 62% similar to a (SYNTHETASE LIGASE CYSTEINYL-TRNA) protein domain (PD118316) which is seen in SYC_HAEIN.

Residues 338-453 are 31% similar to a (SYNTHETASE LIGASE CYSTEINYL-TRNA) protein domain (PD403193) which is seen in SYC_CHLPN.

Residues 109-242 are 82% similar to a (SYNTHETASE LIGASE CYSTEINYL-TRNA AMINOACYL-TRNA CYSRS) protein domain (PD186140) which is seen in SYC_PASMU.

Residues 346-458 are 32% similar to a (SYNTHETASE LIGASE CYSTEINYL-TRNA) protein domain (PD118319) which is seen in SYC_AQUAE.

Residues 2-80 are 78% similar to a (SYNTHETASE LIGASE CYSTEINYL-TRNA AMINOACYL-TRNA CYSRS) protein domain (PD118283) which is seen in SYC_ECOLI.



Paralogs:  Local Blast Search


HD1093 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 314 (E-value = 5.3e-198) place HD1093 in the tRNA-synt_1e family which is described as tRNA synthetases class I (C) catalytic domain (PF01406)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLKIYNTLKREKEEFKPINPAQVGMYVCGVTVYDLCHFGHGRTFVSFDVI
ARYLRYSGYNLRYVRNITDVDDKIIKRALENNESCEALVERMIAEMHNDF
DALNIMRPDVEPRATEHIAEIIAMVEKLIMNGHAYVAADGDVMFDVTSFN
QYGALSRQNLDQLQAGARVEIKSAKKNPMDFVLWKRSKENEPSWLSPWGN
GRPGWHIECSAMNNKELGEHFDIHGGGADLMFPHHENEIAQSCCAHQGEY
VNYWLHTGMLTIDKEKMSKSVGNFFSIRHMLGLYDAESLRYFFLTAHYRS
LLDYSTDNLDLARSALERLYTALRGCDLSVQANGGENYVTAFKTAMDDDF
NTPAALAVLFEMAREVNKLKTEDQQQANALAVCLKELAAVLGLLTQDPDN
FLKGEVNIDQTAEIEALIQQRNQAKANKNWAVADQVRGKLKAMNILLEDT
PTGTVWRKA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAAAATTTATAACACTCTAAAACGTGAGAAAGAAGAATTTAAACC
GATTAACCCTGCACAAGTTGGTATGTATGTCTGCGGCGTGACGGTTTATG
ATCTTTGTCATTTTGGGCATGGGCGGACTTTTGTATCATTTGATGTGATT
GCTCGTTATCTACGTTATTCAGGCTATAACTTACGTTATGTCCGCAATAT
TACCGATGTAGATGATAAAATCATTAAGCGTGCTTTAGAGAATAATGAGA
GTTGTGAAGCACTTGTCGAGCGAATGATTGCAGAAATGCATAATGATTTT
GACGCATTGAACATTATGCGGCCTGATGTAGAGCCTCGTGCAACCGAACA
TATCGCAGAAATTATTGCCATGGTTGAAAAGTTGATTATGAATGGCCATG
CTTATGTTGCCGCAGATGGTGATGTAATGTTTGATGTGACCTCATTTAAT
CAGTATGGTGCTTTGTCTCGCCAAAATCTGGATCAGTTGCAAGCGGGCGC
TAGAGTTGAAATTAAATCAGCTAAGAAGAATCCGATGGATTTTGTCCTAT
GGAAAAGATCTAAAGAAAATGAACCAAGTTGGCTAAGCCCGTGGGGAAAT
GGGCGTCCAGGTTGGCATATTGAATGTTCAGCAATGAACAATAAAGAATT
AGGCGAACATTTTGATATTCATGGTGGTGGTGCGGATTTAATGTTTCCAC
ATCACGAAAATGAAATTGCCCAATCTTGTTGTGCTCATCAAGGTGAATAT
GTCAACTATTGGTTGCATACAGGTATGTTGACGATTGATAAAGAGAAAAT
GTCTAAATCAGTCGGCAATTTTTTTAGCATTCGCCATATGTTAGGGCTTT
ATGATGCTGAATCGTTACGCTATTTCTTTTTGACAGCACATTATCGTTCT
TTATTAGACTACAGCACTGATAACCTAGATTTAGCCCGATCAGCATTAGA
ACGTTTATATACTGCTTTACGAGGCTGTGACTTATCTGTACAAGCGAATG
GCGGTGAAAATTATGTGACCGCTTTTAAAACGGCAATGGACGATGATTTC
AACACGCCAGCAGCATTAGCAGTCTTATTTGAAATGGCTCGTGAAGTGAA
TAAATTAAAAACAGAAGATCAACAGCAAGCAAATGCATTAGCGGTCTGTT
TAAAAGAATTGGCTGCAGTACTTGGCTTATTAACACAAGATCCAGATAAT
TTTTTAAAAGGCGAAGTGAATATCGACCAAACTGCAGAGATTGAAGCATT
AATTCAACAACGTAATCAGGCAAAAGCTAATAAAAATTGGGCAGTAGCGG
ATCAAGTCAGAGGTAAACTCAAAGCAATGAATATCTTGTTAGAAGATACA
CCAACCGGCACAGTTTGGCGTAAAGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy