Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR788 IGR791 IGR795 IGR790 IGR789 IGR787 IGR794 IGR792 IGR793 IGR796 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1089 fdx, - HD1088 HD1095 HD1086 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1089 fdx, - HD1088 HD1095 HD1086 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 HD1096 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 fdx, - HD1088 HD1095 HD1086 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 HD1089
* Calculated from Protein Sequence

Gene ID: HD1092

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ppiB  

Definition:
peptidyl-prolyl cis-trans isomerase B

Gene Start:
870206

Gene Stop:
869697

Gene Length:
510

Molecular Weight*:
18640

pI*:
5.00

Net Charge*:
-5.09

EC:
5.2.1.8  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Hayano,T., Takahashi,N., Kato,S., Maki,N. and Suzuki,M.
Two distinct forms of peptidylprolyl-cis-trans-isomerase are
expressed separately in periplasmic and cytoplasmic compartments of Escherichia coli cells
Biochemistry 30 (12), 3041-3048 (1991)
Medline: 91175755

Kawamukai,M., Matsuda,H., Fujii,W., Utsumi,R. and Komano,T.
Nucleotide sequences of fic and fic-1 genes involved in cell
filamentation induced by cyclic AMP in Escherichia coli
J. Bacteriol. 171 (8), 4525-4529 (1989)
Medline: 89327179



Comment:
This protein accelerates the folding of proteins.


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to peptidyl-prolyl cis-trans isomerase B proteins (PPIase B, also known as rotamase B); residues 1-168 are 76% similar to CYPB_HAEIN [1169177], residues 1-165 are 65% similar to the sequence for peptidyl-prolyl cis-trans isomerase in Neisseria meningitidis MC58 [7226024], and residues 1-169 are 62% similar to CYPB_ECOLI [2507227]. Also significant (though weaker) hits to peptidyl prolyl-cis-trans-isomerase A precursor proteins (PPIase A, rotamase A, cyclophilin A); e.g., residues 2-168 are 54% similar to PPIA_ECOLI [118101], and residues 9-168 are 55% similar to PPIA_SALTY [118108].

COGS Summary:  COGS Search
BeTs to 8 clades of COG0652
COG name: Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family
Functional Class: O
The phylogenetic pattern of COG0652 is --t-Y--CEbRhuj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002130 (Cyclophilin-type peptidyl-prolyl cis-trans isomerase) with a combined E-value of 2.5e-36.
    IPB002130A    9-30
    IPB002130B    36-74
    IPB002130C    84-121


ProDom Summary:  Protein Domain Search
Residues 2-45 are 72% similar to a (ISOMERASE ROTAMASE CIS-TRANS PEPTIDYL-PROLYL) protein domain (PD002184) which is seen in PPIB_HAEIN.

Residues 2-165 are 33% similar to a (T2P11.13) protein domain (PD199517) which is seen in Q9ZVG4_ARATH.

Residues 47-163 are 81% similar to a (ISOMERASE ROTAMASE PEPTIDYL-PROLYL) protein domain (PD199519) which is seen in Q9CM91_PASMU.



Paralogs:  Local Blast Search
HD1092 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 169 (E-value = 7e-57) place HD1092 in the Pro_isomerase family which is described as Cyclophilin type peptidyl-prolyl cis-trans isomerase (PF00160)

PDB Hit:
pdb|2NUL| Peptidylprolyl Isomerase From E. Coli 225 2e-060
pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-P... 223 1e-059
pdb|1CLH| Cyclophilin (Nmr, 12 Structures) 177 6e-046

Gene Protein Sequence:
MITLHTNYGDIKIELYYDKAPITAQNFTDYCQQGFYNGTIFHRVIDGFMI
QGGGMSAGLIEKPTNAPIQNEASNGLSNKRGTLAMARTADPHSASSQFFI
NVADNTFLDYRAKEMFGKTVIQEWGYAVFGEVTEGMEVIDKIKAVKTGNK
GFHQDVPVEDIVIESVTVA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTACATTACATACTAATTATGGCGATATTAAAATCGAATTATATTA
TGATAAAGCGCCAATCACTGCACAAAATTTTACCGATTACTGTCAGCAAG
GTTTTTATAATGGCACTATTTTTCACCGTGTAATTGATGGTTTTATGATT
CAGGGTGGGGGTATGAGCGCAGGTTTAATTGAAAAACCAACCAATGCGCC
TATTCAGAATGAAGCAAGTAATGGCCTAAGCAATAAACGTGGTACATTAG
CAATGGCACGTACTGCTGATCCACATTCAGCAAGCTCACAATTTTTTATC
AATGTAGCGGATAATACTTTTTTAGATTATCGTGCTAAAGAAATGTTCGG
TAAAACGGTTATACAAGAATGGGGCTATGCTGTCTTTGGCGAAGTTACGG
AAGGTATGGAAGTCATTGATAAGATCAAAGCAGTTAAAACAGGTAACAAA
GGGTTTCACCAAGATGTGCCCGTTGAGGATATTGTAATTGAATCGGTCAC
TGTCGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy