Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR788 IGR791 IGR790 IGR789 IGR786 IGR787 IGR794 IGR792 IGR793 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1089 fdx, - HD1088 hscB,hsc20, - HD1085 HD1086 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 HD1089 fdx, - HD1088 hscB,hsc20, - HD1085 HD1086 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 ppiB, - HD1092 lgtD, - HD1090 cca, - HD1091 fdx, - HD1088 hscB,hsc20, - HD1085 HD1086 cysS, - HD1093 hscA,hsc66, - HD1087 HD1094 HD1089
* Calculated from Protein Sequence

Gene ID: HD1091

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cca  

Definition:
tRNA nucleotidyltransferase

Gene Start:
869593

Gene Stop:
868355

Gene Length:
1239

Molecular Weight*:
46672

pI*:
7.20

Net Charge*:
1.59

EC:
2.7.7.25  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Cudny,H., Lupski,J.R., Godson,G.N. and Deutscher,M.P.
Cloning, sequencing, and species relatedness of the Escherichia
coli cca gene encoding the enzyme tRNA nucleotidyltransferase
J. Biol. Chem. 261 (14), 6444-6449 (1986)
Medline: 86196066

Seth M, Thurlow DL, Hou YM.
Poly(C) synthesis by class I and class II CCA-adding enzymes.
Biochemistry. 2002 Apr 9;41(14):4521-32.
PMID: 11926813

Schurer H, Schiffer S, Marchfelder A, Morl M.
This is the end: processing, editing and repair at the tRNA 3'-terminus.
Biol Chem. 2001 Aug;382(8):1147-56. Review.
PMID: 11592395

Comment:
This enzyme carries out synthesis of the tRNA CCA terminus without the direction of a template using multiple accepting and donating subsites within its active site.

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 6760461 in GenBank.

Several strong hits in gapped blast to tRNA nucleotidyltransferase proteins (also known as tRNA adenyltransferase, tRNA CCA-pyrophosphorylase, and CCA-adding enzyme); e.g., residues 1-397 are 53% similar to CCA_HAEIN [1168822], residues 1-397 are 49% similar to CCA_ECOLI [115939], and residues 1-364 are 45% similar to the sequence for tRNA nucleotidyltransferase in Neisseria meningitidis MC58 [7226481]. There are also many weak hits (E values approx 7e-14 and greater) to polyA polymerases and polynucleotide adenylyltransferases.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0617
COG name: tRNA nucleotidyltransferase/poly(A) polymerase
Functional Class: J
The phylogenetic pattern of COG0617 is ----yQvCEbrHuj--oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002646 (Poly A polymerase family) with a combined E-value of 5.3e-44.
    IPB002646A    4-23
    IPB002646B    83-98
    IPB002646C    120-146
    IPB002646D    173-186


ProDom Summary:  Protein Domain Search
Residues 1-82 are 62% similar to a (PROTEOME TRANSFERASE COMPLETE TRNA) protein domain (PD391112) which is seen in Q9KPC6_VIBCH.

Residues 195-319 are 88% similar to a (TRANSFERASE NUCLEOTIDYLTRANSFERASE ENZYME) protein domain (PD014387) which is seen in Q9L7A3_HAEDU.

Residues 6-186 are 91% similar to a (COMPLETE PROTEOME NUCLEOTIDYLTRANSFERASE) protein domain (PD003898) which is seen in Q9L7A3_HAEDU.

Residues 321-397 are 83% similar to a (TRNA NUCLEOTIDYLTRANSFERASE PROTEOME) protein domain (PD328785) which is seen in Q9L7A3_HAEDU.

Residues 6-186 are 65% similar to a (PROTEOME COMPLETE TRNA TRANSFERASE) protein domain (PD377189) which is seen in Q9CP21_PASMU.



Paralogs:  Local Blast Search
HD1091 is paralogously related to HD0604 (3e-13).


Pfam Summary:  Pfam Search
Residues 58 to 217 (E-value = 1.7e-61) place HD1091 in the PolyA_pol family which is described as Poly A polymerase family (PF01743)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQIYLVGGAVRDQLLNLPIKDRDFLVVGATAKELINQGYQQVGADFPVFL
HPVTQQEYALARQERKSGTGYTGFVCDFSPNVTLEQDLIRRDLTINAMAQ
DLTSGQIFDPFGGKTDLANRLLRHISDAFAEDPLRVLRVARFAARFHHLG
FSIAEQTLELMQKMTACGELNHLTAERIWRETEKALHTESPHIYFQVLRK
VNALAILFPEIDQLFGQIQSVKYHLETDRGQHTLLALQQAKLLVKQAHNP
TALLWAVLCHDLGKDLISAEMLPHHYQPNVTGIQLTHQLADRLKVPTAVK
ELALLVNKYHTNCHKIAELDSERVLELFNQLDVWRKPQRLDDFLLACEAD
ARARLGAEYCSYPQATLAIDYFNAANAVNVQAIIADGFKKQAIRDELNNR
RINIIKQIKNAI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAATTTACCTTGTTGGCGGAGCCGTTCGTGATCAGTTGCTCAATTT
ACCGATTAAAGACCGTGATTTCTTAGTAGTAGGTGCTACTGCTAAAGAAC
TAATTAATCAAGGCTATCAACAAGTTGGTGCTGATTTTCCTGTTTTTCTA
CATCCCGTTACCCAACAAGAATATGCGCTCGCGCGGCAAGAGCGAAAAAG
TGGTACCGGCTACACGGGTTTTGTCTGTGATTTTTCGCCAAATGTTACAT
TAGAACAAGATCTAATTCGGCGAGATTTAACCATTAATGCGATGGCTCAA
GACCTAACAAGCGGACAAATTTTCGACCCTTTTGGCGGAAAAACTGACTT
AGCGAACCGACTCTTACGCCATATTTCTGATGCTTTTGCAGAAGATCCAT
TAAGAGTTTTACGTGTCGCACGTTTTGCCGCTCGCTTCCATCATTTAGGC
TTTAGCATTGCCGAACAAACGCTAGAATTAATGCAAAAAATGACCGCTTG
TGGAGAGTTAAATCACCTTACTGCGGAACGTATTTGGCGAGAGACAGAAA
AAGCCTTACACACTGAATCGCCTCACATTTACTTTCAAGTATTGAGAAAA
GTAAATGCATTAGCGATACTTTTCCCTGAAATTGATCAGCTATTTGGTCA
AATTCAATCAGTTAAATATCATCTTGAAACTGATCGTGGCCAACATACAT
TACTTGCACTTCAACAAGCTAAATTACTTGTTAAACAAGCCCATAATCCG
ACCGCTTTACTGTGGGCGGTGCTATGTCATGATCTAGGCAAAGACTTAAT
TTCTGCTGAAATGCTACCGCATCATTATCAACCCAACGTAACCGGCATTC
AGCTCACTCATCAATTAGCTGATCGTTTAAAAGTACCAACCGCTGTAAAA
GAACTTGCCTTATTAGTGAATAAATATCATACAAATTGCCATAAAATCGC
CGAATTAGACAGCGAAAGGGTACTAGAACTCTTTAATCAATTAGATGTAT
GGCGTAAACCTCAAAGGCTAGACGACTTCTTACTCGCTTGTGAAGCAGAT
GCACGTGCTCGATTAGGCGCTGAGTATTGTTCTTATCCACAAGCAACATT
GGCAATTGACTATTTTAATGCCGCTAATGCTGTTAATGTACAAGCAATAA
TTGCCGATGGTTTTAAAAAACAAGCTATTCGCGATGAATTAAACAATAGG
CGAATTAACATCATCAAACAAATAAAAAATGCTATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy