Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR785 IGR788 IGR789 IGR786 IGR783 IGR787 IGR782 IGR779 IGR778 IGR784 IGR780 IGR781 dat1, - HD1077 ompP1,fadL, - HD1078 HD1079 yfhF, - HD1084 fdx, - HD1088 nifU, - HD1083 HD1080 hscB,hsc20, - HD1085 HD1086 nifS,iscS, - HD1082 hscA,hsc66, - HD1087 recB, - HD1076 dat1, - HD1077 ompP1,fadL, - HD1078 HD1079 yfhF, - HD1084 fdx, - HD1088 nifU, - HD1083 HD1080 hscB,hsc20, - HD1085 HD1086 nifS,iscS, - HD1082 hscA,hsc66, - HD1087 recB, - HD1076 dat1, - HD1077 ompP1,fadL, - HD1078 yfhF, - HD1084 fdx, - HD1088 nifU, - HD1083 HD1080 hscB,hsc20, - HD1085 HD1086 nifS,iscS, - HD1082 hscA,hsc66, - HD1087 recB, - HD1076 HD1079
* Calculated from Protein Sequence

Gene ID: HD1082

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nifS  iscS  

Definition:
cysteine desulfurase

Gene Start:
861727

Gene Stop:
862947

Gene Length:
1221

Molecular Weight*:
45596

pI*:
6.50

Net Charge*:
-4.54

EC:
4.4.1.-  

Functional Class:
Other categories; Other  

Pathway: pathway table

Secondary Evidence:
Frazzon J, Fick JR, Dean DR.
Biosynthesis of iron-sulphur clusters is a complex and highly conserved process.
Biochem Soc Trans. 2002;30(4):680-5.
PMID: 12196163

Comment:
From GenBank (gi:13432196):
This protein catalyzes the removal of elemental sulfur from cysteine to produce alanine, and belongs to the class-V of pyrodixal-phosphate-dependent aminotransferases (NifS/IscS)` subfamily). Pyridoxal phosphatase is a cofactor.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to nifs protein sequences, e.g.residues 1-400 are 83% similar to nifS protein in Haemophilus influenzae Rd (1075069|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG1104
COG name: Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes (NifS family)
Functional Class: E
The phylogenetic pattern of COG1104 is A--kYQvCeBRHuj---lINX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000192 (Aminotransferase class-V) with a combined E-value of 1.7e-10.
    IPB000192A    5-13
    IPB000192B    205-214


ProDom Summary:  Protein Domain Search
Residues 58-210 are 86% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in ISCS_PASMU.

Residues 345-395 are 82% similar to a (PYRIDOXAL LYASE CYSTEINE DESULFURASE) protein domain (PD406052) which is seen in ISCS_ECOLI.

Residues 44-112 are 76% similar to a (AMINOTRANSFERASE PROTEOME PYRIDOXAL LYASE) protein domain (PD311278) which is seen in ISCS_PSEAE.

Residues 266-345 are 67% similar to a (LYASE PYRIDOXAL DESULFURASE PHOSPHATE) protein domain (PD189309) which is seen in ISCS_PSEAE.

Residues 1-43 are 79% similar to a (LYASE CYSTEINE DESULFURASE 4.4.1.-) protein domain (PD351786) which is seen in ISCS_ECOLI.

Residues 114-212 are 45% similar to a (AMINOTRANSFERASE V PROTEOME COMPLETE) protein domain (PD393971) which is seen in Q9RXU1_DEIRA.

Residues 350-406 are 80% similar to a (LYASE CYSTEINE PYRIDOXAL DESULFURASE) protein domain (PD002061) which is seen in ISCS_PASMU.

Residues 213-264 are 90% similar to a (LYASE PHOSPHATE 4.4.1.- PYRIDOXAL) protein domain (PD001054) which is seen in ISCS_HAEIN.



Paralogs:  Local Blast Search
HD1082 is paralogously related to HD0464 (6e-17).


Pfam Summary:  Pfam Search
Residues 15 to 371 (E-value = 9.8e-116) place HD1082 in the Aminotran_5 family which is described as Aminotransferase class-V (PF00266)

PDB Hit:
pdb|1ECX|B Chain B, Nifs-Like Protein >gi|7546479|pdb|1ECX|A Ch... 243 4e-065
pdb|1EG5|B Chain B, Nifs-Like Protein >gi|7546280|pdb|1EG5|A Ch... 234 1e-062
pdb|1C0N|A Chain A, Csdb Protein, Nifs Homologue 85 1e-017

Gene Protein Sequence:
MKLPIYLDYAATTPMDERVVQKMMQYMTKDGIFGNPASRSHKFGWEAEEA
VDIARNHIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITL
KTEHKAVLDTCRQLEREGFEVTYLEPESDGLLDLTKLVEAIRPDTILISI
MHVNNEIGVVQDIKAIGEICRARKIIFHVDATQSVGKLAVNVQELKVDLM
SFSSHKLYGPKGIGGLYVCRKPRIRIEAIIHGGGHERGMRSGTLPVHQIV
GMGEAYRIAKEEMATEMPRLKALRDRLYHGFQAIEEVYVNGSMEEGKRVD
TNLNMSFNFVEGESLMMALRDIAVSSGSACTSASLEPSYVLRAIGRNDEL
AHSSIRFSLGRWATEEEIDYTIELVKKSILKLRELSPLWEMFKEGIDLSK
IEWNHH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTACCAATTTATTTGGATTACGCTGCAACAACACCGATGGATGA
ACGGGTTGTGCAAAAAATGATGCAATATATGACTAAAGATGGCATCTTTG
GTAATCCTGCTTCACGTTCTCATAAATTTGGTTGGGAAGCTGAAGAAGCG
GTTGATATCGCCCGTAATCATATTGCTGATTTAATCGGTGCCGACTCGCG
TGAAATTGTGTTTACCTCAGGTGCAACTGAGTCTGACAATTTAGCCATTA
AAGGCGCGGCACACTTTTATCAAACGAAAGGTAAACATATCATCACGCTT
AAGACTGAACATAAAGCTGTGCTAGATACTTGCCGTCAATTAGAACGCGA
AGGGTTTGAGGTGACTTACTTAGAGCCTGAGTCAGATGGTTTATTAGATT
TAACTAAATTAGTTGAGGCGATCCGTCCAGATACGATTTTAATTTCAATT
ATGCATGTAAATAATGAAATTGGTGTAGTGCAAGATATTAAAGCGATTGG
TGAGATTTGTCGCGCACGTAAAATTATTTTTCACGTAGATGCTACACAGT
CAGTTGGCAAATTAGCGGTCAATGTACAAGAACTAAAAGTCGATTTAATG
TCTTTTTCTAGCCATAAATTATATGGACCAAAAGGTATTGGTGGTTTATA
CGTGTGTCGTAAACCGCGGATTAGGATTGAAGCCATTATTCATGGTGGCG
GCCATGAGCGTGGTATGCGTTCTGGCACCTTACCAGTACATCAAATTGTT
GGTATGGGGGAAGCCTATCGCATTGCTAAAGAAGAAATGGCAACAGAGAT
GCCACGTTTAAAAGCATTACGCGATCGTTTATATCACGGCTTTCAAGCAA
TTGAAGAAGTGTACGTGAATGGTTCAATGGAAGAAGGTAAGCGGGTTGAT
ACTAATTTAAATATGAGTTTTAACTTTGTTGAGGGAGAATCCTTAATGAT
GGCATTAAGAGATATTGCGGTATCTTCGGGATCAGCTTGTACCTCAGCAA
GTTTAGAGCCATCTTATGTATTACGTGCAATTGGCCGTAATGATGAATTA
GCCCATAGCTCAATTCGTTTTTCATTAGGTCGTTGGGCAACAGAAGAAGA
AATTGATTACACCATTGAATTAGTGAAGAAATCGATTTTAAAACTTAGAG
AGCTTTCTCCATTATGGGAAATGTTTAAAGAAGGTATTGATTTAAGCAAA
ATTGAGTGGAATCACCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy