Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR785 IGR783 IGR777 IGR782 IGR779 IGR778 IGR784 IGR780 IGR781 dat1, - HD1077 ompP1,fadL, - HD1078 HD1079 yfhF, - HD1084 nifU, - HD1083 HD1080 hscB,hsc20, - HD1085 nifS,iscS, - HD1082 HD1075 recB, - HD1076 dat1, - HD1077 ompP1,fadL, - HD1078 HD1079 yfhF, - HD1084 nifU, - HD1083 HD1080 hscB,hsc20, - HD1085 nifS,iscS, - HD1082 HD1075 recB, - HD1076 dat1, - HD1077 ompP1,fadL, - HD1078 nifU, - HD1083 HD1080 hscB,hsc20, - HD1085 nifS,iscS, - HD1082 HD1075 recB, - HD1076 HD1079 yfhF, - HD1084
* Calculated from Protein Sequence

Gene ID: HD1077

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dat1  

Definition:
methylated-DNA--protein-cysteine methyltransferase

Gene Start:
859392

Gene Stop:
858835

Gene Length:
558

Molecular Weight*:
20610

pI*:
10.40

Net Charge*:
10.32

EC:
2.1.1.63  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Potter,P.M., Wilkinson,M.C., Fitton,J., Carr,F.J., Brennand,J.,
Cooper,D.P. and Margison,G.P.
Characterisation and nucleotide sequence of ogt, the
O6-alkylguanine-DNA-alkyltransferase gene of E. coli
Nucleic Acids Res. 15 (22), 9177-9193 (1987)
MEDLINE: 88067749

Harris,L.C., Potter,P.M. and Margison,G.P.
Site directed mutagenesis of two cysteine residues in the E. coli
ogt O6-alkylguanine DNA alkyltransferase protein
Biochem. Biophys. Res. Commun. 187 (1), 425-431 (1992)
MEDLINE: 92392360



Comment:
From Genbank:[gi:118247]
This protein is involved in the repair of alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the 0-6 position to a cysteine residue in the enzyme.This is a suicide reaction: the enzyme is irreversibly inactivated.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to methylated-DNA-protein-cysteine methyltransferases; e.g., residues 5-179 are 50% similar to methylated-DNA--protein-cysteine methyltransferase in Haemophilus influenzae Rd (16272351|).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0350
COG name: Methylated DNA-protein cysteine methyltransferase
Functional Class: L
The phylogenetic pattern of COG0350 is amtkyqv-EBRhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001497 (Methylated-DNA--protein-cysteine methyltransferase) with a combined E-value of 1.4e-49.
    IPB001497A    84-110
    IPB001497B    111-161


ProDom Summary:  Protein Domain Search
Residues 91-170 are 65% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE) protein domain (PD002730) which is seen in Q9CLY1_PASMU.

Residues 6-89 are 39% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE DNA) protein domain (PD068052) which is seen in OGT_HAEIN.



Paralogs:  Local Blast Search
HD1077 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 84 to 169 (E-value = 5.9e-48) place HD1077 in the Methyltransf_1 family which is described as 6-O-methylguanine DNA methyltransferase, DNA binding domain (PF01035)

PDB Hit:
pdb|1SFE| Ada O6-Methylguanine-Dna Methyltransferase From Es... 93 2e-020
pdb|1EH6|A Chain A, Human O6-Alkylguanine-Dna Alkyltransferase 81 9e-017
pdb|1QNT|A Chain A, X-Ray Structure Of Human O6alkylguanine-Dna... 81 1e-016

Gene Protein Sequence:
MNKNIYYQYYTSPVGQLLLIANQQGLIGVEFEQEQLTRQTVEWQPISSND
PMYAVFSKTCDLLDRYFAGEAVSFSQLDFLAPQGTAFQQAVWQALRHIPY
GKTTSYGKIAVRLGKPKAMRAVGGAVGRNPISILVPCHRVLGKNNSLTGF
GGGLATKRYLLTLEGVKFKDKGTEFVNPKQKKWCP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAAAACATTTATTATCAATACTATACTTCACCTGTTGGACAACT
ATTATTAATTGCAAATCAACAAGGTTTAATTGGTGTTGAATTTGAACAAG
AGCAACTCACTCGCCAAACAGTAGAATGGCAACCTATCAGTAGTAATGAT
CCTATGTATGCCGTTTTCAGTAAAACATGTGATCTTTTAGACCGCTATTT
TGCCGGTGAAGCGGTCTCTTTTTCGCAACTTGATTTCTTAGCACCGCAAG
GCACGGCTTTTCAACAGGCCGTTTGGCAAGCATTACGCCATATTCCATAT
GGAAAAACAACAAGCTATGGTAAAATTGCAGTACGTTTGGGAAAACCAAA
AGCAATGCGGGCGGTTGGCGGTGCCGTGGGACGTAATCCGATCTCAATTT
TGGTGCCTTGTCATCGTGTATTGGGTAAAAATAATAGTTTGACCGGCTTT
GGAGGAGGGCTAGCGACTAAACGTTATTTACTGACGTTAGAAGGGGTTAA
ATTTAAGGATAAAGGCACTGAGTTTGTCAATCCAAAGCAAAAGAAATGGT
GTCCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy