Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR777 IGR782 IGR779 IGR778 IGR776 IGR780 IGR781 IGR775 dat1, - HD1077 grpE, - HD1073 ompP1,fadL, - HD1078 HD1079 HD1080 potD, - HD1074 nifS,iscS, - HD1082 HD1075 recB, - HD1076 dat1, - HD1077 grpE, - HD1073 ompP1,fadL, - HD1078 HD1079 HD1080 potD, - HD1074 nifS,iscS, - HD1082 HD1075 recB, - HD1076 dat1, - HD1077 grpE, - HD1073 ompP1,fadL, - HD1078 HD1079 potD, - HD1074 nifS,iscS, - HD1082 HD1075 recB, - HD1076 HD1080
* Calculated from Protein Sequence

Gene ID: HD1076

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
recB  

Definition:
exodeoxyribonuclease V beta chain

Gene Start:
855163

Gene Stop:
858759

Gene Length:
3597

Molecular Weight*:
139371

pI*:
5.60

Net Charge*:
-23.21

EC:
3.1.11.5  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Arnold,D.A. and Kowalczykowski,S.C.
Facilitated loading of RecA protein is essential to recombination by RecBCD enzyme
J. Biol. Chem. 275 (16), 12261-12265 (2000)
Medline: 20229837

Finch,P.W., Storey,A., Chapman,K.E., Brown,K., Hickson,I.D. and
Emmerson,P.T.
Complete nucleotide sequence of the Escherichia coli recB gene
Nucleic Acids Res. 14 (21), 8573-8582 (1986)
Medline: 87066729



Comment:
This enzyme is required for efficient DNA repair; it catalyzes the unwinding of double-stranded DNA and the cleavage of
single-stranded DNA and it stimulates local genetic recombination.
All of these activities require concomitant hydrolysis of ATP.

For other "rec" genes, see HD0410 (recA), HD1342 (recJ), HD1604 (recO), HD1921 (recG), HD0325 (recR), HD0411 (recX), HD0475 (recQ), HD0815 (recN), HD0849 (recF), HD0626 (recD).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to exodeoxyribonuclease V protein sequences,e.g. residues 4-1197 are 39% similar to exodeoxyribonuclease V in Haemophilus influenzae strain Rd KW20 (1169572|).

Residues 4-1197 are 35% similar to exodeoxyribonuclease V in Escherichia coli (119668|).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1074
COG name: ATP-dependent exoDNAse (exonuclease V), beta subunit, - helicase and exonuclease domains
Functional Class: L
The phylogenetic pattern of COG1074 is --------ebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000212 (UvrD/REP helicase) with a combined E-value of 1.9e-53.
    IPB000212A    19-29
    IPB000212B    50-67
    IPB000212C    398-409
    IPB000212D    429-442
    IPB000212E    460-478
    IPB000212F    747-765
    IPB000212G    814-826


ProDom Summary:  Protein Domain Search
Residues 742-825 are 50% similar to a (EXODEOXYRIBONUCLEASE V HYDROLASE PROTEOME) protein domain (PD131442) which is seen in EX5B_ECOLI.

Residues 7-67 are 69% similar to a (HELICASE DNA PROTEOME COMPLETE ATP-BINDING DNA-BINDING) protein domain (PD000627) which is seen in Q9CNB6_PASMU.

Residues 363-477 are 53% similar to a (HELICASE COMPLETE PROTEOME DNA) protein domain (PD126505) which is seen in EX5B_ECOLI.

Residues 356-466 are 63% similar to a (HELICASE DNA PROTEOME COMPLETE ATP-DEPENDENT ATP-BINDING) protein domain (PD001658) which is seen in EX5B_HAEIN.

Residues 91-195 are 41% similar to a (V EXODEOXYRIBONUCLEASE PROTEOME BETA) protein domain (PD024187) which is seen in EX5B_HAEIN.

Residues 525-741 are 42% similar to a (V EXODEOXYRIBONUCLEASE CHAIN BETA) protein domain (PD024188) which is seen in Q9CNB6_PASMU.

Residues 742-825 are 47% similar to a (V EXODEOXYRIBONUCLEASE PROTEOME BETA) protein domain (PD271707) which is seen in Q9KPP6_VIBCH.

Residues 971-1174 are 41% similar to a (V EXODEOXYRIBONUCLEASE CHAIN BETA) protein domain (PD024877) which is seen in EX5B_HAEIN.

Residues 966-1085 are 33% similar to a (V PROTEOME EXODEOXYRIBONUCLEASE SUBUNIT) protein domain (PD297590) which is seen in Q9KPP6_VIBCH.

Residues 4-68 are 67% similar to a (HELICASE COMPLETE PROTEOME NUCLEASE) protein domain (PD366909) which is seen in Q9KPP6_VIBCH.



Paralogs:  Local Blast Search

HD1076 is paralogously related to HD0571 (9e-12) and HD1032 (2e-09).


Pfam Summary:  Pfam Search
Residues 1 to 720 (E-value = 2.5e-72) place HD1076 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

PDB Hit:
pdb|3PJR|A Chain A, Helicase Substrate Complex >gi|2781090|pdb|... 74 9e-014

Gene Protein Sequence:
MNNLDPLALPLNGTSLIEASAGTGKTFTMANLYLRLLLGIGCQPLTVEEI
LVVTFTKAATEELRDRIRRNIKACREFFCDYDPNQIDQNKDNFYSQLYER
VDNLDEAKLRLRIAEREIDLASIFTIHSFCQKILSQFAFDSGIRFDNDWQ
TDESHLLQQLSEEIWREQFYPLSLQECEIIYNELEEPLKALKMVQSFIGI
ELPALSAEQKRIFTPELSTRYLIEYKNFLQQIKQYWQINGNEIVTIINAE
LKKIYKTGEKKALNRTSYQPRYLATYQSELDNWANSMDLTLPKNFERFCQ
DFIASKAQEGAVTTLSHPHFQQNQQWLNIYQQKYSDKKKPFLLYQFLVRL
RAKLADYKITHSEKSFNDMLTLLNQALKSDNGDQLAAKVRCQYPFAMIDE
FQDTDKQQYEIFSKIFMQGEQTNRGFIMIGDPKQSIYQFRGTDIFTYLNA
ANEVQEKRTLPKNWRSLPSIVQAANRLFSFPPESPHSPFLYDEIGFQQAI
AKETDTELKGLAHCIFYLQPKFDFQRAAEHCAYQIQQQLKQMEAGKFGLK
LTDNPAIQPFQAKDIAILVRNKKEANYVKQALANCGIRSVYLSEDRSVYQ
SDLAQDLLWLLYACLNPYQQSTLLTVVGSSLWGLSATEIYQLKHNEIAWD
NLVERFVDYQHIWQRQGILPMLHQLFLCEGLIKRLCANPQTSDRNLTDLL
HLAELLQNAMSSLENESALVRWYEHQLADDNKNEAHQLRLESENQLVQIV
TIHKAKGLQYPIVWLPFIGEERGYTRKKDKNLKLYRDATNQECWLFGHAD
EQTKTLLEKGEHAEDLRLLYVALTRAESQLNVILPQQFTENWNAVHYLLS
DGELFLNKQFNPKTTVDYLDNKQFDDYIKLDEKALVDDWRPTIASQADPI
VRTFDAIIRKEGQITSFTALHHYHQAGYEKQYPARNVLIDTADHDSQQLL
SDLMLEPISEAEQAYSVYNFPHSAKVGTILHYFFEKADFQQALELAQVAT
ICEQLNIEEQWQTVLQQWFTRVFATPFAEQQIALQDISCDQRLNEWGFYL
RLTNEHALKELNELLQKYGSISKDLPELQLPQLAGYVRGSVDCLAKVNGK
FYVIDYKSNFLGSSAQDYSQQNLVKTIGQYRYDLQYLLYSLAVHRYLRSR
LAEHYDYERDFGGAVYLFLRGMNGTANSGVFFDKPSLTLITKMDELFC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAATCTTGATCCATTAGCATTGCCATTAAATGGTACCTCACTGAT
TGAAGCCTCTGCAGGAACAGGCAAAACGTTCACAATGGCAAATTTATATT
TACGTTTATTGTTGGGCATTGGTTGTCAGCCGTTAACGGTAGAAGAAATT
TTAGTGGTTACTTTTACCAAAGCGGCAACCGAAGAATTGCGTGATCGTAT
TCGTCGTAATATTAAAGCCTGTCGAGAATTTTTTTGTGATTATGATCCTA
ACCAAATTGATCAAAATAAAGATAATTTCTATAGTCAACTTTATGAAAGG
GTTGATAATTTAGATGAAGCAAAATTACGGTTACGTATTGCAGAACGAGA
AATTGATTTAGCCAGTATTTTCACTATTCATAGTTTCTGCCAAAAAATAT
TATCGCAGTTTGCGTTTGATTCTGGCATTCGATTTGATAATGATTGGCAG
ACAGATGAAAGCCATTTATTACAGCAGTTAAGTGAAGAGATATGGCGAGA
GCAATTTTACCCGCTGAGTTTGCAAGAATGCGAGATCATTTATAACGAAT
TAGAAGAACCATTAAAAGCACTTAAAATGGTTCAATCATTTATTGGGATT
GAATTGCCGGCGTTATCTGCCGAACAAAAAAGAATATTTACGCCAGAGCT
ATCTACTCGTTATCTAATTGAATATAAGAATTTTTTACAGCAAATCAAAC
AGTATTGGCAAATAAATGGTAACGAAATTGTTACTATTATTAATGCGGAA
TTAAAAAAAATATATAAAACAGGGGAGAAAAAAGCCTTAAATCGTACCTC
TTATCAACCCCGTTATCTTGCAACATATCAATCAGAGCTTGATAATTGGG
CTAATTCAATGGATCTTACTTTACCAAAAAATTTCGAGCGCTTTTGTCAA
GATTTTATCGCAAGTAAAGCGCAAGAGGGAGCAGTAACGACCCTATCACA
TCCGCATTTTCAGCAAAACCAACAATGGTTAAATATTTATCAACAAAAAT
ATTCGGATAAAAAAAAGCCATTTTTGCTTTATCAATTTTTAGTGAGGCTA
CGGGCTAAACTGGCAGATTATAAAATAACGCATAGTGAAAAAAGTTTTAA
TGATATGCTAACTTTGCTGAATCAAGCGTTAAAAAGCGATAACGGCGATC
AATTAGCGGCCAAAGTTCGTTGCCAATACCCTTTTGCGATGATTGATGAA
TTTCAAGATACGGATAAACAGCAATACGAAATTTTTAGCAAAATTTTTAT
GCAAGGAGAGCAAACCAACCGTGGTTTTATCATGATCGGTGATCCTAAGC
AGTCTATTTATCAATTCCGTGGCACTGATATCTTTACCTATTTAAATGCA
GCCAATGAAGTGCAAGAAAAACGAACTTTGCCTAAAAATTGGCGATCGTT
GCCGAGCATTGTTCAAGCCGCTAACCGCTTGTTTTCTTTTCCGCCAGAAT
CACCACATTCGCCCTTTCTATATGATGAAATTGGTTTTCAACAAGCCATA
GCTAAAGAAACTGATACTGAACTAAAGGGGCTAGCACATTGCATTTTCTA
TTTACAGCCAAAGTTTGACTTTCAACGCGCAGCAGAACATTGTGCTTATC
AAATTCAACAACAGTTAAAACAGATGGAAGCGGGCAAATTTGGTTTAAAA
CTTACAGATAATCCCGCTATTCAGCCATTCCAAGCAAAAGATATAGCCAT
TTTGGTTCGCAATAAAAAAGAGGCAAATTATGTTAAACAAGCATTAGCAA
ATTGTGGTATCCGTTCAGTGTATTTGTCAGAAGATCGCAGTGTTTATCAA
TCAGATCTTGCACAAGATCTATTATGGTTACTGTATGCTTGTCTAAATCC
TTATCAACAATCAACATTATTAACCGTTGTGGGTTCAAGTTTATGGGGAC
TTTCTGCAACAGAAATTTATCAACTTAAACATAACGAAATCGCGTGGGAT
AATTTAGTTGAGCGTTTTGTTGATTATCAACACATTTGGCAACGGCAAGG
TATTCTACCAATGTTGCATCAACTATTTTTGTGCGAAGGGTTGATTAAAC
GGCTTTGTGCTAATCCGCAAACAAGCGATCGTAATTTAACTGATTTATTA
CATTTAGCTGAACTGTTACAAAATGCAATGTCGAGTTTGGAAAATGAATC
AGCGTTAGTGCGTTGGTATGAACATCAATTAGCCGATGATAACAAAAATG
AAGCGCATCAATTACGCTTAGAAAGTGAAAATCAGCTAGTACAAATTGTC
ACTATTCACAAAGCTAAGGGTTTGCAATATCCAATAGTTTGGTTGCCTTT
TATCGGTGAAGAGCGTGGTTATACTCGTAAAAAAGATAAAAATCTTAAAC
TTTATCGAGACGCAACCAATCAAGAGTGTTGGCTATTTGGTCATGCAGAT
GAACAAACTAAAACTTTGCTTGAAAAAGGAGAGCATGCGGAAGACTTACG
GTTATTATACGTCGCATTAACGCGAGCAGAATCACAATTGAACGTGATTT
TACCACAACAGTTTACAGAAAATTGGAATGCGGTCCATTATTTATTGAGT
GATGGAGAACTATTTTTAAATAAGCAATTTAATCCGAAGACCACAGTGGA
TTACTTAGACAACAAGCAATTTGATGATTATATCAAGTTAGATGAAAAAG
CGTTAGTCGATGACTGGCGGCCAACCATCGCTAGCCAAGCTGATCCAATA
GTACGTACATTTGATGCTATTATTCGCAAAGAAGGGCAAATTACGAGTTT
TACTGCGTTACATCATTACCACCAAGCAGGTTATGAAAAGCAATATCCTG
CTAGAAATGTTTTAATCGATACAGCAGATCATGATAGTCAGCAATTATTA
TCAGATCTCATGCTTGAACCAATTTCTGAAGCAGAACAAGCGTATTCAGT
GTATAACTTTCCACACAGTGCGAAAGTTGGGACGATTTTACATTACTTTT
TTGAAAAAGCGGATTTTCAGCAAGCGCTTGAATTAGCCCAAGTAGCGACT
ATTTGTGAGCAACTGAATATCGAAGAACAATGGCAAACTGTATTGCAACA
ATGGTTTACACGAGTATTTGCCACGCCTTTTGCTGAACAACAAATTGCTT
TGCAAGATATTAGTTGCGATCAACGTTTGAATGAATGGGGCTTTTATTTA
CGGCTAACTAACGAACACGCTTTGAAAGAATTAAATGAGTTATTGCAAAA
ATATGGTTCAATTTCTAAAGATTTACCTGAGTTACAGTTACCACAATTAG
CTGGGTATGTACGCGGTTCAGTTGATTGCTTAGCGAAAGTAAATGGTAAA
TTTTATGTGATTGATTATAAATCGAATTTCTTAGGTTCTTCAGCACAAGA
TTATAGCCAACAAAATTTGGTGAAAACAATCGGACAATATCGCTACGATT
TACAATATCTGCTTTATAGTTTAGCTGTGCATCGTTACTTAAGATCACGC
TTAGCTGAACACTATGACTATGAACGCGATTTTGGTGGCGCGGTGTATCT
GTTTTTACGCGGTATGAATGGCACAGCCAATAGCGGAGTATTTTTCGATA
AACCTAGCTTGACCTTAATAACAAAAATGGACGAATTATTTTGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy