Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR769 IGR777 IGR773 IGR768 IGR770 IGR771 IGR772 IGR774 IGR776 IGR775 HD1065 hrpA, - HD1067 HD1070 pfl,yfiD, - HD1064 HD1071 grpE, - HD1073 hrpA, - HD1068 ung, - HD1066 potD, - HD1074 HD1075 recB, - HD1076 HD1065 hrpA, - HD1067 HD1070 pfl,yfiD, - HD1064 HD1071 grpE, - HD1073 hrpA, - HD1068 ung, - HD1066 potD, - HD1074 HD1075 recB, - HD1076 hrpA, - HD1067 pfl,yfiD, - HD1064 HD1071 grpE, - HD1073 hrpA, - HD1068 hrpA, - HD1069 hrpA, - HD1069 HD1065 HD1070 ung, - HD1066 potD, - HD1074 HD1075 recB, - HD1076
* Calculated from Protein Sequence

Gene ID: HD1070

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
851026

Gene Stop:
850832

Gene Length:
195

Molecular Weight*:
7658

pI*:
11.40

Net Charge*:
10.94

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant matches in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD1070 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MYYPHRMKRHLQKNRVNQPLDAMQKALLAQLTDISNLDYYRLRSRIHSLS
NIKKLSSNKPLHTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTACCCACATCGAATGAAACGTCACCTGCAAAAAAATCGCGTAAA
TCAACCGCTTGATGCTATGCAAAAAGCATTGTTGGCACAATTAACCGATA
TCTCTAATTTAGATTATTACCGTTTACGTAGCCGTATTCATAGCCTGTCT
AATATAAAAAAACTGAGCTCAAACAAGCCGCTACACACGAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy