Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR769 IGR765 IGR773 IGR768 IGR770 IGR763 IGR771 IGR764 IGR766 IGR762 IGR772 IGR774 IGR767 HD1065 hrpA, - HD1067 HD1070 HD1060 pfl,yfiD, - HD1064 HD1071 impA, - HD1063 HD1061 grpE, - HD1073 hrpA, - HD1068 ung, - HD1066 psi516, - HD1057 HD1062 menC, - HD1055 HD1065 hrpA, - HD1067 HD1070 HD1060 pfl,yfiD, - HD1064 HD1071 impA, - HD1063 HD1061 grpE, - HD1073 hrpA, - HD1068 ung, - HD1066 psi516, - HD1057 HD1062 menC, - HD1055 hrpA, - HD1067 pfl,yfiD, - HD1064 impA, - HD1063 HD1061 grpE, - HD1073 hrpA, - HD1068 hrpA, - HD1069 hrpA, - HD1069 HD1065 HD1060 HD1071 HD1070 ung, - HD1066 psi516, - HD1057 HD1062 menC, - HD1055
* Calculated from Protein Sequence

Gene ID: HD1066

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ung  

Definition:
uracil-DNA glycosylase (UDG)

Gene Start:
846313

Gene Stop:
846984

Gene Length:
672

Molecular Weight*:
24856

pI*:
9.70

Net Charge*:
6.78

EC:
3.2.2.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Varshney,U., Hutcheon,T. and van de Sande,J.H.
Sequence analysis, expression, and conservation of Escherichia coli uracil DNA glycosylase and its gene (ung)
J. Biol. Chem. 263 (16), 7776-7784 (1988)
MEDLINE: 88227981

Lundquist,A.J., Beger,R.D., Bennett,S.E., Bolton,P.H. and
Mosbaugh,D.W.
Site-directed mutagenesis and characterization of uracil-DNA
glycosylase inhibitor protein. Role of specific carboxylic amino
acids in complex formation with Escherichia coli uracil-DNA
glycosylase
J. Biol. Chem. 272 (34), 21408-21419 (1997)
MEDLINE: 97407932

Ravishankar,R., Bidya Sagar,M., Roy,S., Purnapatre,K., Handa,P.,
Varshney,U. and Vijayan,M.
X-ray analysis of a complex of Escherichia coli uracil DNA
glycosylase (EcUDG) with a proteinaceous inhibitor. The structure
elucidation of a prokaryotic UDG
Nucleic Acids Res. 26 (21), 4880-4887 (1998)
MEDLINE: 98451580

Putnam,C.D., Shroyer,M.J., Lundquist,A.J., Mol,C.D., Arvai,A.S.,
Mosbaugh,D.W. and Tainer,J.A.
Protein mimicry of DNA from crystal structures of the uracil-DNA
glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
J. Mol. Biol. 287 (2), 331-346 (1999)
MEDLINE: 99182421

Xiao,G., Tordova,M., Jagadeesh,J., Drohat,A.C., Stivers,J.T. and
Gilliland,G.L.
Crystal structure of Escherichia coli uracil DNA glycosylase and
its complexes with uracil and glycerol: structure and glycosylase
mechanism revisited
Proteins 35 (1), 13-24 (1999)
MEDLINE: 99188668



Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to prokaryotic and eukaryotic uracil-DNA glycosylases; e.g., residues 1-219 are 67% similar to UNG_HAEIN [1174879], residues 1-219 are 56% similar to the sequence for uracil-DNA glycosylase in Neisseria meningitidis MC58 .[7226461], residues 3-217 are 56% similar to UNG_ECOLI [137035], and residues 3-218 are 49% similar to UNG_MOUSE [2501520], a uracil-DNA glycosylase precursor.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0692
COG name: Uracil DNA glycosylase
Functional Class: L
The phylogenetic pattern of COG0692 is ----y---ebrhujgpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002043 (Uracil-DNA glycosylase) with a combined E-value of 6.6e-77.
    IPB002043A    52-76
    IPB002043B    106-139
    IPB002043C    157-167
    IPB002043D    177-189
    IPB002043E    194-217


ProDom Summary:  Protein Domain Search
Residues 15-219 are 67% similar to a (GLYCOSYLASE URACIL-DNA GLYCOSIDASE) protein domain (PD001589) which is seen in UNG_HAEIN.



Paralogs:  Local Blast Search


HD1066 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 48 to 208 (E-value = 1.3e-78) place HD1066 in the UDG family which is described as Uracil DNA glycosylase superfamily (PF03167)

PDB Hit:
pdb|1EUI|A Chain A, Escherichia Coli Uracil-Dna Glycosylase Com... 254 6e-069
pdb|1UUG|A Chain A, Escherichia Coli Uracil-Dna Glycosylase:inh... 254 6e-069
pdb|1EUG|A Chain A, Crystal Structure Of Escherichia Coli Uraci... 253 1e-068

Gene Protein Sequence:
MNSWTEAIGEEKVQPYFQQLLQQVYQARASGKIIYPPQHEVFSAFALTDF
KAVKVVILGQDPYHGPNQAHGLAFSVKPSVVPPPSLVNIYKELAQDIAGF
QVPSHGYLIDWAKQGVLLLNTVLTVQQGMAHSHATLGWEIFTDKVIAQLN
DHRENLVFLLWGSHAQKKGQFINRSRHCVLTAPHPSPLSAHRGFFGCQHF
SKANAYLQSKGIATINWQLPLVV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGTTGGACCGAAGCGATTGGTGAGGAAAAAGTACAGCCATATTT
TCAACAGCTTTTGCAACAAGTATATCAAGCACGTGCGAGTGGTAAAATTA
TTTATCCACCGCAACATGAGGTTTTTAGTGCTTTTGCATTGACTGACTTT
AAGGCGGTTAAGGTTGTCATTTTGGGCCAAGATCCTTATCACGGTCCTAA
TCAAGCGCATGGTTTAGCGTTTTCTGTGAAACCGTCTGTTGTACCGCCTC
CATCATTAGTGAATATATATAAAGAATTAGCTCAAGATATTGCCGGTTTT
CAGGTTCCTAGCCATGGCTATTTAATCGATTGGGCAAAACAAGGGGTGTT
ATTACTCAACACAGTGTTGACTGTTCAACAAGGAATGGCGCATTCTCACG
CTACCTTGGGGTGGGAAATATTCACGGATAAAGTGATTGCGCAATTGAAT
GATCATCGAGAAAACCTAGTCTTTTTATTGTGGGGAAGTCATGCGCAGAA
GAAGGGGCAATTTATTAATCGATCACGCCATTGTGTTTTAACGGCGCCCC
ATCCATCGCCATTGTCTGCTCATCGAGGCTTTTTCGGTTGTCAGCATTTT
TCTAAAGCGAATGCATACTTACAAAGTAAGGGCATTGCTACCATTAATTG
GCAATTACCGTTAGTTGTGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy