Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR769 IGR765 IGR768 IGR770 IGR763 IGR771 IGR764 IGR766 IGR762 IGR761 IGR767 HD1065 hrpA, - HD1067 HD1060 pfl,yfiD, - HD1064 impA, - HD1063 HD1061 metG, - HD1054 hrpA, - HD1068 ung, - HD1066 psi516, - HD1057 HD1062 menC, - HD1055 HD1065 hrpA, - HD1067 HD1060 pfl,yfiD, - HD1064 impA, - HD1063 HD1061 metG, - HD1054 hrpA, - HD1068 ung, - HD1066 psi516, - HD1057 HD1062 menC, - HD1055 hrpA, - HD1067 pfl,yfiD, - HD1064 impA, - HD1063 HD1061 metG, - HD1054 hrpA, - HD1068 HD1065 HD1060 ung, - HD1066 psi516, - HD1057 HD1062 menC, - HD1055
* Calculated from Protein Sequence

Gene ID: HD1062

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
endonuclease IV

Gene Start:
844115

Gene Stop:
844960

Gene Length:
846

Molecular Weight*:
31596

pI*:
6.50

Net Charge*:
-3.91

EC:
3.1.21.2  4.2.99.18  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Levin,J.D., Shapiro,R. and Demple,B.
Metalloenzymes in DNA repair. Escherichia coli endonuclease IV and
Saccharomyces cerevisiae Apn1
J. Biol. Chem. 266 (34), 22893-22898 (1991)
MEDLINE: 92078146

Hosfield,D.J., Guan,Y., Haas,B.J., Cunningham,R.P. and Tainer,J.A.
Structure of the DNA repair enzyme endonuclease IV and its DNA
complex: double-nucleotide flipping at abasic sites and
three-metal-ion catalysis
Cell 98 (3), 397-408 (1999)
MEDLINE: 99385796

Kerins SM, Collins R, McCarthy TV.
Characterisation of an Ap endonuclease IV 3'-5' exonuclease activity.
J Biol Chem. 2002 Nov 19 [epub ahead of print]
PMID: 12444080

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to prokaryotic endonuclease IV proteins and eukaryotic apurinic/apyrimidinic endonucleases; e.g., residues 1-276 are 67% similar to END4_ECOLI [2506194], residues 4-281 are 42% similar to residues 2-278 of APN1_CAEEL [1353160], and residues 5-281 are 40% similar to residues 18-296 of the major apurinic/apyrimidinic endonuclease (3"-repair diesterase) apn1p in Saccharomyces cerevisiae [6322735].

COGS Summary:  COGS Search
BeTs to 11 clades of COG0648
COG name: Endonuclease IV
Functional Class: L
The phylogenetic pattern of COG0648 is -mtkyqv-ebr---gp--in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001719 (AP endonucleases family 2) with a combined E-value of 4.7e-42.
    IPB001719A    3-9
    IPB001719B    28-39
    IPB001719C    66-75
    IPB001719D    175-190
    IPB001719E    207-240


ProDom Summary:  Protein Domain Search
Residues 1-68 are 64% similar to a (ENDONUCLEASE IV DNA HYDROLASE) protein domain (PD023523) which is seen in END4_ECOLI.

Residues 69-237 are 69% similar to a (ENDONUCLEASE IV DNA ZINC) protein domain (PD001488) which is seen in END4_ECOLI.

Residues 69-116 are 70% similar to a (ENDONUCLEASE IV HYDROLASE METAL-BINDING) protein domain (PD297062) which is seen in END4_BUCAI.



Paralogs:  Local Blast Search
HD1062 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 239 (E-value = 9.3e-87) place HD1062 in the AP_endonuc_2 family which is described as AP endonuclease family 2 (PF01261)

PDB Hit:
pdb|1QUM|A Chain A, Crystal Structure Of Escherichia Coli Endon... 384 7e-108
pdb|1QTW|A Chain A, High-Resolution Crystal Structure Of The Es... 382 3e-107

Gene Protein Sequence:
MKYIGAHVSAAGGVENAVLRAVEIGGNAFALFTKNQRQWQAATLKAETIE
KFKRFCQVHQFTADQILPHDSYLINLGHPELENRQKSVAAFIDEMQRVNQ
LGLKLLNFHPGSHLNKISERDCLAYIAESINIAIKTVPNVVAVIENTAGQ
GSNMGYRFEHLAEIIEQVEDKSRVGVCLDTCHLFSAGYDISSWQACEKTF
TDFDQIVGYAFLRGMHLNGSKTALGSRVDRHHCLRDGTIGTAVFEYIMQH
HQFDHIPLILETIQPEIWAEEIQFLRDLSAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATATATTGGCGCTCACGTTAGCGCAGCGGGCGGTGTTGAAAATGC
GGTATTACGTGCCGTAGAAATTGGTGGTAATGCTTTTGCATTATTTACTA
AAAATCAGCGACAATGGCAGGCAGCTACATTAAAAGCAGAAACGATCGAA
AAATTTAAACGTTTTTGCCAAGTGCATCAATTTACGGCTGATCAGATTTT
ACCGCACGATAGTTATTTAATTAATCTTGGTCATCCTGAATTAGAGAATC
GCCAAAAATCAGTGGCGGCGTTTATTGATGAAATGCAACGGGTCAATCAA
TTAGGCTTAAAATTATTAAATTTTCATCCGGGATCGCATTTGAATAAGAT
CTCTGAGCGAGATTGTTTAGCGTATATTGCAGAATCAATTAATATTGCGA
TCAAAACGGTGCCTAATGTAGTCGCAGTGATTGAAAATACAGCAGGGCAA
GGATCGAATATGGGCTATCGTTTTGAACATTTAGCGGAAATTATTGAACA
AGTTGAAGATAAAAGCCGAGTGGGCGTATGTTTAGATACTTGCCACCTAT
TTTCTGCCGGATATGATATTAGTTCTTGGCAGGCGTGTGAGAAAACCTTT
ACCGATTTTGATCAAATTGTTGGTTATGCTTTCTTACGTGGTATGCATTT
AAATGGTTCGAAAACGGCACTAGGTAGCCGCGTTGATCGGCATCATTGTT
TAAGGGATGGTACCATTGGTACGGCAGTGTTTGAATATATAATGCAACAT
CATCAATTTGACCATATCCCATTGATTTTGGAAACGATTCAACCAGAAAT
TTGGGCGGAAGAAATCCAGTTTTTACGCGATTTATCGGCTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy