Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR756 IGR765 IGR758 IGR760 IGR763 IGR764 IGR766 IGR759 IGR762 IGR761 IGR757 HD1060 ndk, - HD1053 HD1061 HD1050 metG, - HD1054 HD1051 psi516, - HD1057 HD1049 HD1062 menC, - HD1055 psi, - HD1052 HD1060 ndk, - HD1053 HD1061 HD1050 metG, - HD1054 HD1051 psi516, - HD1057 HD1049 HD1062 menC, - HD1055 psi, - HD1052 ndk, - HD1053 HD1061 HD1050 metG, - HD1054 HD1060 HD1051 psi516, - HD1057 HD1049 HD1062 menC, - HD1055 psi, - HD1052
* Calculated from Protein Sequence

Gene ID: HD1054

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
metG  

Definition:
methionyl-tRNA synthetase

Gene Start:
841049

Gene Stop:
838995

Gene Length:
2055

Molecular Weight*:
77807

pI*:
6.50

Net Charge*:
-5.22

EC:
6.1.1.10  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Methionine metabolism
Selenoamino acid metabolism

Secondary Evidence:
Deniziak MA, Barciszewski J.
Methionyl-tRNA synthetase.
Acta Biochim Pol. 2001;48(2):337-50. Review.
PMID: 11732605

Crepin T, Schmitt E, Blanquet S, Mechulam Y.
Structure and Function of the C-Terminal Domain of Methionyl-tRNA Synthetase.
Biochemistry. 2002 Oct 29;41(43):13003-11.
PMID: 12390027

Dardel,F., Fayat,G. and Blanquet,S.
Molecular cloning and primary structure of the Escherichia coli
methionyl-tRNA synthetase gene
J. Bacteriol. 160 (3), 1115-1122 (1984)
Medline: 85054627

Dardel,F., Panvert,M. and Fayat,G.
Transcription and regulation of expression of the Escherichia coli
methionyl-tRNA synthetase gene
Mol. Gen. Genet. 223 (1), 121-133 (1990)
Medline: 91080852


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to methionine tRNA synthetase proteins; e.g. residues 5-684 are 79% similar to (U32807) methionyl-tRNA synthetase of Haemophilus influenzae, residues 5-684 are 64% similar to (AE000300) methionine tRNA synthetase of Escherichia coli, residues 5-683 are 56% similar to (AL162752) methionyl-tRNA synthetase of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0143
COG name: Methionyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0143 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002547 (Putative tRNA binding domain) with a combined E-value of 3.4e-13.
    IPB002547A    28-42
    IPB002547B    643-660
    IPB002547A    599-613
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 3.3e-06.
    IPB001412A    14-24
    IPB001412B    327-337


ProDom Summary:  Protein Domain Search
Residues 315-431 are 73% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000476) which is seen in SYM_PASMU.

Residues 68-145 are 75% similar to a (SYNTHETASE LIGASE METHIONYL-TRNA) protein domain (PD222057) which is seen in SYM_HAEIN.

Residues 372-436 are 78% similar to a (SYNTHETASE METHIONYL-TRNA AMINOACYL-TRNA) protein domain (PD328105) which is seen in SYM_HAEIN.

Residues 6-64 are 89% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000389) which is seen in SYM_HAEIN.

Residues 253-307 are 85% similar to a (SYNTHETASE LIGASE METHIONYL-TRNA) protein domain (PD210990) which is seen in SYM_PASMU.

Residues 251-309 are 62% similar to a (SYNTHETASE PROTEOME COMPLETE) protein domain (PD412772) which is seen in Q9PFV8_XYLFA.

Residues 248-301 are 73% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD225365) which is seen in SYM_ECOLI.

Residues 437-538 are 43% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD008558) which is seen in Q9HYC7_PSEAE.

Residues 146-244 are 84% similar to a (SYNTHETASE METHIONYL-TRNA LIGASE) protein domain (PD273663) which is seen in SYM_PASMU.

Residues 439-537 are 76% similar to a (SYNTHETASE LIGASE METHIONYL-TRNA) protein domain (PD344499) which is seen in SYM_HAEIN.

Residues 580-683 are 84% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD002123) which is seen in SYM_HAEIN.



Paralogs:  Local Blast Search


HD1054 is paralogously related to HD1132 (2e-06) and HD0272 (2e-05).


Pfam Summary:  Pfam Search
Residues 2 to 373 (E-value = 4.9e-06) place HD1054 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)
Residues 588 to 682 (E-value = 1.5e-38) place HD1054 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)

PDB Hit:
pdb|1QQT|A Chain A, Methionyl-Trna Synthetase From Escherichia ... 815 0.0
pdb|1A8H| Methionyl-Trna Synthetase From Thermus Thermophilus 141 3e-034

Gene Protein Sequence:
MSNKRKMLVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGHQVYFVCA
DDAHGTPIMLNAAKQGITPEQLIAKAKADHIADFQSFNISFDNYHSTHSE
ENRNITTAMYKTLRDKGLIKTRVISQLFDPEKQMFLPDRFVKGTCPKCQA
EDQYGDNCEVCASTYSPMDLINPHSVVSGATPIVKQSEHFFFDLPNFEAM
LKTWTHSGSLQPQIANKMQEWFESGLQQWDISRDAPYFGFPIPDTENKFF
YVWLDAPIGYMASFKNLCDRTGLNYEEFWQKESKTELYHFIGKDIVYFHS
LFWPAMLEGCDQRKPTNIFAHGYVTVDGVKMSKSRGTFIQASTYLKHIDP
ECLRYYYAAKLNERIEDLDLNLDDFVQRVNSDIVNKLVNLASRNASFITK
RFAGNLADKLEDEALFAEFVAQASNIADHYEAREYNKAIRLIMDLCDKAN
KYVDDKAPWVIAKQADREAELHAVCSMGIELFRILISYLKPVLPQLATRA
EAFLQTELRWDNIASPLLNQNVAPFKSLFSRLEKKQIDRVIEETKALFST
QPKTEQPQVASTMNDNQQQNIEPIAAEISIDDFAKLDLRVAKVIQCEAVP
ESNKLLKFQLDLGDHQRQVLSGIKAAYSKPEELNGRFVIMVANLAPRKMK
FGLSEGMILSAGTGGADLFLLSGDCGIRPGMQVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGAATAAAAGAAAAATGTTGGTTACTTGTGCATTACCCTATGCCAA
TGGCGCCATTCACTTAGGCCATATGTTAGAACATATACAAGCAGATATTT
GGGTTCGTTTTCAACGGATGAGAGGCCACCAAGTTTATTTTGTCTGTGCA
GATGATGCCCATGGCACCCCCATTATGCTAAATGCTGCCAAACAAGGCAT
CACCCCAGAACAACTCATTGCCAAAGCCAAAGCCGATCATATAGCCGATT
TTCAAAGTTTTAACATTAGCTTCGATAATTACCATTCTACACACAGTGAA
GAAAATCGAAACATTACCACCGCAATGTATAAAACATTACGGGATAAAGG
CCTCATTAAAACGCGTGTCATTTCGCAACTATTCGATCCAGAAAAACAGA
TGTTTTTACCTGATCGCTTTGTGAAAGGCACCTGCCCAAAATGCCAAGCT
GAAGATCAATATGGTGATAACTGTGAAGTCTGTGCGTCTACATATAGTCC
TATGGATTTAATTAACCCACATTCTGTTGTATCCGGTGCTACGCCTATTG
TCAAACAATCTGAACATTTCTTTTTTGACTTACCCAACTTTGAAGCAATG
TTAAAAACTTGGACGCATTCAGGTTCATTACAACCTCAAATTGCTAATAA
AATGCAAGAATGGTTTGAAAGTGGCTTACAACAATGGGATATCAGCCGTG
ATGCGCCTTATTTTGGTTTCCCGATTCCAGACACTGAAAATAAATTCTTC
TATGTATGGTTAGACGCACCAATCGGTTATATGGCTTCATTCAAAAATCT
GTGTGATCGAACCGGTTTAAATTATGAAGAATTTTGGCAAAAAGAAAGTA
AAACTGAACTTTATCACTTTATCGGCAAAGATATCGTCTACTTCCATAGT
TTATTTTGGCCTGCTATGCTAGAAGGCTGTGATCAGCGTAAACCAACCAA
TATATTCGCACATGGCTATGTCACCGTCGATGGTGTCAAAATGTCAAAAT
CACGTGGTACTTTTATTCAAGCAAGCACTTACTTAAAACATATTGATCCA
GAATGTTTACGTTATTACTACGCCGCCAAACTAAATGAACGGATTGAAGA
TTTAGATCTAAATCTTGACGATTTTGTACAACGTGTTAACAGTGATATTG
TTAATAAATTAGTCAATCTTGCCTCACGTAATGCAAGTTTTATTACGAAA
CGGTTTGCTGGCAACTTAGCAGATAAATTAGAAGATGAAGCCCTCTTTGC
AGAATTTGTAGCACAAGCTAGCAACATCGCCGATCATTATGAAGCAAGAG
AATACAATAAAGCTATTCGCTTAATTATGGACTTATGTGATAAAGCCAAT
AAATATGTTGATGATAAAGCACCGTGGGTAATCGCTAAACAAGCAGATCG
TGAAGCTGAATTGCATGCAGTTTGCTCAATGGGCATTGAATTATTCCGTA
TTTTAATCAGCTATTTAAAACCCGTTCTACCACAATTAGCAACGCGTGCA
GAAGCATTTTTACAAACTGAACTACGTTGGGATAATATTGCTAGTCCATT
ACTAAATCAAAACGTTGCACCCTTTAAATCTCTCTTCTCACGCTTAGAGA
AAAAACAAATTGATCGCGTGATTGAAGAAACTAAAGCCCTATTCTCAACA
CAACCTAAAACAGAACAACCACAAGTAGCATCAACAATGAACGATAATCA
ACAACAAAATATTGAACCCATCGCAGCAGAAATCAGCATTGATGATTTTG
CCAAACTAGATTTACGTGTTGCCAAAGTAATCCAATGTGAAGCTGTACCA
GAATCAAATAAACTATTAAAATTCCAATTAGATTTAGGAGATCACCAACG
GCAAGTTCTCTCCGGCATTAAAGCGGCTTATAGCAAACCGGAAGAATTAA
ATGGTCGCTTTGTAATTATGGTTGCCAACTTAGCACCACGCAAAATGAAA
TTTGGTTTATCCGAAGGAATGATTCTATCGGCAGGAACAGGGGGCGCAGA
CTTGTTCTTACTTTCAGGCGACTGTGGCATTCGCCCAGGCATGCAAGTAA
AATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy