Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR754 IGR756 IGR758 IGR760 IGR763 IGR764 IGR759 IGR762 IGR761 IGR757 IGR755 HD1060 ndk, - HD1053 HD1061 HD1050 metG, - HD1054 priB, - HD1046 rpL9, - HD1048 HD1051 psi516, - HD1057 HD1049 menC, - HD1055 psi, - HD1052 HD1060 ndk, - HD1053 HD1061 HD1050 metG, - HD1054 priB, - HD1046 rpL9, - HD1048 HD1051 psi516, - HD1057 HD1049 menC, - HD1055 psi, - HD1052 ndk, - HD1053 HD1061 HD1050 metG, - HD1054 HD1060 rpL9, - HD1048 HD1051 psi516, - HD1057 HD1049 menC, - HD1055 psi, - HD1052 rpS18,rpsR, - HD1047 priB, - HD1046 rpS18,rpsR, - HD1047
* Calculated from Protein Sequence

Gene ID: HD1053

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ndk  

Definition:
nucleoside diphosphate kinase

Gene Start:
838925

Gene Stop:
838509

Gene Length:
417

Molecular Weight*:
15447

pI*:
6.30

Net Charge*:
-1.38

EC:
2.7.4.6  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Hama,H., Almaula,N., Lerner,C.G., Inouye,S. and Inouye,M.
Nucleoside diphosphate kinase from Escherichia coli; its
overproduction and sequence comparison with eukaryotic enzymes
Gene 105 (1), 31-36 (1991)
MEDLINE: 92039015

Ray,N.B. and Mathews,C.K.
Nucleoside diphosphokinase: a functional link between intermediary
metabolism and nucleic acid synthesis
Curr. Top. Cell. Regul. 33, 343-357 (1992)
MEDLINE: 92362321

Almaula,N., Lu,Q., Delgado,J., Belkin,S. and Inouye,M.
Nucleoside diphosphate kinase from Escherichia coli
J. Bacteriol. 177 (9), 2524-2529 (1995)
MEDLINE: 95247689



Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ndk proteins; e.g.
residues 2-138 are 57% similar to [2498069] nucleoside-diphosphate kinase of Pseudomonas aeruginosa, residues 2-138 are 54% similar to (AL139074) nucleoside diphosphate kinase of Campylobacter jejuni, residues 1-137 are 56% similar to [1171679] nucleoside diphosphate kinase of Haemophilus influenzae .

COGS Summary:  COGS Search
BeTs to 15 clades of COG0105
COG name: Nucleoside diphosphate kinase
Functional Class:  F
The phylogenetic pattern of COG0105 is amtkyq-cebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001564 (Nucleoside diphosphate kinase) with a combined E-value of 3.4e-52.
    IPB001564A    3-31
    IPB001564B    49-82
    IPB001564C    99-132


ProDom Summary:  Protein Domain Search
Residues 3-137 are 61% similar to a (KINASE DIPHOSPHATE NUCLEOSIDE TRANSFERASE) protein domain (PD001018) which is seen in Q9CM17_PASMU.



Paralogs:  Local Blast Search

HD1053 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 138 (E-value = 3.7e-67) place HD1053 in the NDK family which is described as Nucleoside diphosphate kinase (PF00334)

PDB Hit:
pdb|1NHK|R Chain R, Nucleoside Diphosphate Kinase (E.C.2.7.4.6)... 145 2e-036
pdb|1NUE|A Chain A, Nucleoside Triphosphate, Nucleoside Diphosp... 115 3e-027
pdb|1NSK|L Chain L, Mol_id: 1; Molecule: Nucleoside Diphosphate... 115 3e-027

Gene Protein Sequence:
MLQQTLCLIKPDATQRNLIGKIISYLENAGLKIKAIKKLQLTQAQAEKFY
LEHQDKPFFASLVGFMISAPIVAIVLEGENAIAHYRELMGATNPEQREAG
TIRALYAISNQENSVHGSDSETSAKREIDYFFSKEEIC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTCAACAAACACTTTGTTTAATTAAACCTGATGCGACACAACGTAA
TCTCATCGGAAAAATTATTAGCTATTTAGAAAATGCAGGCCTTAAAATCA
AAGCCATCAAAAAATTGCAATTAACACAAGCACAAGCGGAAAAATTTTAC
CTTGAACATCAAGATAAACCGTTTTTTGCATCATTAGTTGGATTTATGAT
CTCAGCACCAATTGTCGCAATAGTATTAGAAGGCGAAAATGCCATTGCAC
ATTACCGTGAATTAATGGGCGCGACTAATCCAGAACAACGAGAAGCGGGC
ACAATTCGTGCGCTTTATGCAATCAGTAATCAAGAAAATTCTGTACACGG
CTCAGACTCAGAAACTTCGGCCAAACGTGAAATAGATTACTTCTTTAGCA
AAGAGGAAATTTGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy