Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR747 IGR756 IGR754 IGR753 IGR749 IGR752 IGR758 IGR751 IGR748 IGR750 IGR757 IGR755 purD, - HD1043 HD1050 HD1044 rpS18,rpsR, - HD1047 rpS6, - HD1045 rpL9, - HD1048 HD1051 HD1040 HD1041 HD1049 HD1036 psi, - HD1052 gcpE, - HD1037 hisS, - HD1039 purD, - HD1043 HD1050 HD1044 rpS18,rpsR, - HD1047 rpS6, - HD1045 rpL9, - HD1048 HD1051 HD1040 HD1041 HD1049 HD1036 psi, - HD1052 gcpE, - HD1037 hisS, - HD1039 purD, - HD1043 HD1050 purD, - HD1042 purD, - HD1042 rpL9, - HD1048 HD1051 HD1040 HD1041 HD1049 HD1036 psi, - HD1052 gcpE, - HD1037 hisS, - HD1039 priB, - HD1046 rpS6, - HD1045 rpS18,rpsR, - HD1047 HD1044 priB, - HD1046
* Calculated from Protein Sequence

Gene ID: HD1043

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purD  

Definition:
phosphoribosylamine--glycine ligase

Gene Start:
833073

Gene Stop:
832444

Gene Length:
630

Molecular Weight*:
21735

pI*:
5.00

Net Charge*:
-4.51

EC:
6.3.4.13  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Cheng,Y.S., Shen,Y., Rudolph,J., Stern,M., Stubbe,J., Flannigan,K.A. andSmith,J.M.
Glycinamide ribonucleotide synthetase from Escherichia coli:
cloning, overproduction, sequencing, isolation, and characterization
Biochemistry 29 (1), 218-227 (1990)
MEDLINE: 90212572

Wang,W., Kappock,T.J., Stubbe,J. and Ealick,S.E.
X-ray crystal structure of glycinamide
ribonucleotide synthetase from Escherichia coli
Biochemistry 37 (45), 15647-15662 (1998)
MEDLINE: 99060041

Comment:
HD1043 and HD1042 may be separated by a false stop.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to garS sequences. Residues 1-207 are 85% similar to PUR2_PASMU (13431795) and 83% similar to PUR2_HAEIN (1172752).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0151
COG name: Phosphoribosylamine-glycine ligase
Functional Class:  F
The phylogenetic pattern of COG0151 is amtkyqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000115 (Phosphoribosylglycinamide synthetase) with a combined E-value of 1.1e-66.
    IPB000115A    2-31
    IPB000115B    65-112
    IPB000115C    143-157


ProDom Summary:  Protein Domain Search
Residues 1-83 are 77% similar to a (LIGASE SYNTHETASE) protein domain (PD002771) which is seen in PUR2_HAEIN.

Residues 84-207 are 87% similar to a (LIGASE SYNTHETASE CARBOXYLASE COMPLETE PROTEOME) protein domain (PD000180) which is seen in PUR2_HAEIN.



Paralogs:  Local Blast Search

HD1043 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 102 (E-value = 3.7e-61) place HD1043 in the GARS_N family which is described as Phosphoribosylglycinamide synthetase, N domain (PF02844)
Residues 104 to 186 (E-value = 8.2e-49) place HD1043 in the GARS_B family which is described as Phosphoribosylglycinamide synthetase, B domain (PF02842)

PDB Hit:
pdb|1GSO|A Chain A, Glycinamide Ribonucleotide Synthetase (Gar-... 330 9e-092

Gene Protein Sequence:
MNILIIGNGGREHALAWKARKSPLAKKVFVAPGNAGTAREEGIENVAIAS
TDITALVAFAKENAVGLTIVGPEAPLVAGVVDAFRANGLKIFGPTQAAAQ
LEGSKAFTKDFLARHKIPTAEYQNFTEIAPALAYLKTKGAPIVIKADGLA
AGKGVIVAMTLTEAEEAVKDMLSGNAFGDAGSRVVIEEFLDGEEASFIVM
VDGENVEGR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATTTTAATTATTGGTAATGGCGGTCGCGAACACGCATTAGCTTG
GAAAGCCCGTAAATCTCCACTTGCTAAAAAAGTGTTTGTTGCACCCGGCA
ATGCAGGAACGGCACGAGAAGAAGGCATTGAAAATGTTGCAATCGCAAGC
ACAGATATCACCGCTTTGGTAGCCTTTGCTAAAGAAAATGCGGTCGGCTT
GACGATTGTAGGTCCGGAAGCACCTTTAGTTGCTGGCGTTGTTGATGCTT
TTAGGGCAAATGGTTTAAAGATTTTTGGTCCGACACAAGCAGCCGCTCAG
TTAGAAGGTTCAAAAGCCTTTACTAAAGATTTTTTAGCGCGCCACAAAAT
ACCAACGGCTGAATATCAAAATTTTACTGAAATAGCGCCCGCTTTAGCTT
ATTTAAAAACAAAAGGCGCACCTATTGTAATTAAAGCAGATGGCTTAGCT
GCGGGTAAAGGCGTGATTGTAGCGATGACATTAACTGAAGCAGAAGAAGC
GGTAAAAGATATGCTATCAGGCAATGCATTTGGCGATGCCGGTAGCCGTG
TCGTGATCGAAGAATTTCTTGATGGCGAAGAAGCTAGTTTTATCGTAATG
GTAGACGGTGAAAATGTGGAAGGGCGATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy