Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR747 IGR756 IGR754 IGR753 IGR749 IGR752 IGR758 IGR751 IGR748 IGR750 IGR757 IGR755 purD, - HD1043 HD1050 HD1044 rpS18,rpsR, - HD1047 rpS6, - HD1045 rpL9, - HD1048 HD1051 HD1040 HD1041 HD1049 HD1036 gcpE, - HD1037 hisS, - HD1039 purD, - HD1043 HD1050 HD1044 rpS18,rpsR, - HD1047 rpS6, - HD1045 rpL9, - HD1048 HD1051 HD1040 HD1041 HD1049 HD1036 gcpE, - HD1037 hisS, - HD1039 purD, - HD1043 HD1050 purD, - HD1042 purD, - HD1042 rpL9, - HD1048 HD1051 HD1040 HD1041 HD1049 HD1036 gcpE, - HD1037 hisS, - HD1039 priB, - HD1046 rpS6, - HD1045 rpS18,rpsR, - HD1047 HD1044 priB, - HD1046
* Calculated from Protein Sequence

Gene ID: HD1042

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purD  

Definition:
phosphoribosylamine--glycine ligase

Gene Start:
832466

Gene Stop:
832209

Gene Length:
258

Molecular Weight*:
9444

pI*:
9.90

Net Charge*:
3.18

EC:
6.3.4.13  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Cheng,Y.S., Shen,Y., Rudolph,J., Stern,M., Stubbe,J.,
Flannigan,K.A. and Smith,J.M.
Glycinamide ribonucleotide synthetase from Escherichia coli:
cloning, overproduction, sequencing, isolation, and
characterization
Biochemistry 29 (1), 218-227 (1990)
Medline: 90212572

Wang,W., Kappock,T.J., Stubbe,J. and Ealick,S.E.
X-ray crystal structure of glycinamide ribonucleotide synthetase
from Escherichia coli
Biochemistry 37 (45), 15647-15662 (1998)
Medline: 99060041



Comment:
HD1042 and HD1043 may be a single gene; check for internal stop codon.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phosphoribosylamine--glycine ligase sequences,e.g.residues 5-83 are 72% similar to phosphoribosylamine--glycine ligase in Haemophilus influenzae strain Rd KW20 (1172752|).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0151
COG name: Phosphoribosylamine-glycine ligase
Functional Class:  F
The phylogenetic pattern of COG0151 is amtkyqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000115 (Phosphoribosylglycinamide synthetase) with a combined E-value of 1.1e-06.
    IPB000115H    61-81


ProDom Summary:  Protein Domain Search
Residues 5-79 are 58% similar to a (LIGASE SYNTHETASE) protein domain (PD002812) which is seen in PUR2_PASMU.



Paralogs:  Local Blast Search
HD1042 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 80 (E-value = 2.9e-26) place HD1042 in the GARS_C family which is described as Phosphoribosylglycinamide synthetase, C domain (PF02843)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VKMWKGDEITAIPTTTPPHKVFLAGVEEKAGKLVTNGGRVLCATALGNSV
YEAQQQALKLAEQINWQERFYRADIGYRAVQREKA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAATGTGGAAGGGCGATGAAATTACCGCTATTCCTACTACAACTCC
ACCACACAAGGTTTTTCTAGCGGGTGTCGAAGAAAAGGCGGGTAAATTAG
TCACTAATGGCGGTAGAGTATTATGTGCAACGGCTTTAGGTAATTCAGTG
TATGAAGCTCAACAACAAGCATTGAAATTGGCTGAACAAATTAATTGGCA
AGAGCGTTTCTATCGTGCCGATATTGGTTATCGTGCCGTACAGCGCGAAA
AAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy