Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR747 IGR754 IGR753 IGR749 IGR752 IGR745 IGR751 IGR748 IGR750 IGR746 IGR755 purD, - HD1043 HD1034 HD1044 rpS18,rpsR, - HD1047 rpS6, - HD1045 rpL9, - HD1048 HD1040 HD1041 HD1049 HD1036 gcpE, - HD1037 hisS, - HD1039 argH, - HD1033 purD, - HD1043 HD1034 HD1044 rpS18,rpsR, - HD1047 rpS6, - HD1045 rpL9, - HD1048 HD1040 HD1041 HD1049 HD1036 gcpE, - HD1037 hisS, - HD1039 argH, - HD1033 purD, - HD1043 HD1034 purD, - HD1042 purD, - HD1042 HD1040 HD1041 HD1049 HD1036 gcpE, - HD1037 hisS, - HD1039 argH, - HD1033 priB, - HD1046 rpS6, - HD1045 rpL9, - HD1048 HD1044 rpS18,rpsR, - HD1047 priB, - HD1046
* Calculated from Protein Sequence

Gene ID: HD1039

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hisS  

Definition:
histidyl-tRNA synthetase (hisS)

Gene Start:
829392

Gene Stop:
830663

Gene Length:
1272

Molecular Weight*:
47476

pI*:
6.10

Net Charge*:
-4.28

EC:
6.1.1.21  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Histidine metabolism

Secondary Evidence:
Gillet S, Hoang CB, Schmitter JM, Fukui T, Blanquet S, Hountondji C.
Affinity labeling of Escherichia coli histidyl-tRNA synthetase with reactive ATP analogues. Identification of labeled amino acid residues by matrix assisted laser desorption-ionization mass spectrometry.
Eur J Biochem. 1996 Oct 1;241(1):133-41.
PMID: 8898898

Freedman,R., Gibson,B., Donovan,D., Biemann,K., Eisenbeis,S.,
Parker,J. and Schimmel,P.
Primary structure of histidine-tRNA synthetase and characterization of hisS transcripts
J. Biol. Chem. 260 (18), 10063-10068 (1985)
Medline: 85261421

Eisenbeis,S.J. and Parker,J.
The nucleotide sequence of the promoter region of hisS, the
structural gene for histidyl-tRNA synthetase
Gene 18 (2), 107-114 (1982)
Medline: 83028525

Arnez,J.G., Harris,D.C., Mitschler,A., Rees,B., Francklyn,C.S. and
Moras,D.
Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate
EMBO J. 14 (17), 4143-4155 (1995)
Medline: 96016186



Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to histidyl-tRNA synthetase proteins; e.g. residues 1-423 are 78% similar to (U32721) histidyl-tRNA synthetase of Haemophilus influenzae, residues 1-419 are 66% similar to (AF047040) histidyl-tRNA synthetase; aminoacyl-tRNA synthetase of Salmonella typhimurium, residues 1-419 are %65 similar to (M11843) histidine-tRNA synthetase of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0124
COG name: Histidyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0124 is amtkYQVCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 308-416 are 65% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000606) which is seen in SYH_PASMU.

Residues 224-307 are 85% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD001912) which is seen in SYH_HAEIN.

Residues 76-288 are 31% similar to a (SYNTHETASE HISTIDYL-TRNA LIGASE) protein domain (PD416012) which is seen in SYH_METTH.

Residues 73-222 are 70% similar to a (SYNTHETASE LIGASE HISTIDYL-TRNA) protein domain (PD403250) which is seen in SYH_SALTY.

Residues 69-156 are 93% similar to a (SYNTHETASE HISTIDYL-TRNA AMINOACYL-TRNA) protein domain (PD404510) which is seen in SYH_HAEIN.

Residues 5-68 are 92% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD336444) which is seen in SYH_HAEIN.

Residues 308-406 are 30% similar to a (SYNTHETASE LIGASE HISTIDINE--TRNA) protein domain (PD355581) which is seen in SYH_BUCAI.



Paralogs:  Local Blast Search


HD1039 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 158 (E-value = 2.3e-43) place HD1039 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 329 to 422 (E-value = 9.8e-16) place HD1039 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

PDB Hit:
pdb|1KMM|C Chain C, Histidyl-Trna Synthetase Complexed With His... 559 2e-160
pdb|1HTT|A Chain A, Histidyl-Trna Synthetase >gi|1942450|pdb|1H... 559 3e-160
pdb|1QE0|A Chain A, Crystal Structure Of Apo S. Aureus Histidyl... 305 5e-084

Gene Protein Sequence:
VAKTIQAIRGMNDCATTESPLWQWVESNVRNVLASYGYSEVRMPIVESTP
LFARAIGEVTDVVSKEMYTFWDNDEQLTLRPEGTAGCVRAAIQHGWIYNN
EQRLWYMGPMFRHERPQKGRYRQFHQAGVEVFGIANPEIDAELILLTARL
WQALGIEQHLSLQLNSIGSLAARANYRAALVDFLANHTALMNDEEKERLV
KNPLRILDTKNQALQAVLNDAPKLLDYLDEESRQHFAQLCQLLDAMGIRY
EVNPKLVRGLDYYNKTVFEWVTSALGSQGTVCGGGRYDGLVEQLGGHATQ
GVGFAIGLERLVLLVQEVNKTMSLPKAVDIYLVYAGDNTTLKAFQIAEQI
RNALPQLRVMTHCSGGNFKKQFKRADKVEAKIALVIGESELATQTIVLKE
LQNSSEQISIDQADLLAELSKRF$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCAAAAACAATTCAAGCAATTCGTGGTATGAACGATTGTGCAACAAC
AGAAAGTCCATTATGGCAATGGGTAGAAAGCAACGTCCGCAATGTATTGG
CTAGTTATGGTTATTCTGAAGTGCGTATGCCAATTGTCGAAAGTACCCCG
CTTTTTGCTCGAGCCATCGGCGAAGTGACAGATGTTGTTTCAAAAGAAAT
GTATACTTTTTGGGATAATGATGAACAACTGACACTCCGGCCTGAAGGCA
CAGCCGGTTGCGTGCGTGCAGCGATTCAGCATGGCTGGATTTATAATAAT
GAACAACGTTTATGGTATATGGGACCAATGTTCCGCCATGAACGACCTCA
AAAAGGTCGTTATCGTCAATTTCACCAAGCAGGCGTAGAAGTTTTTGGTA
TTGCTAATCCAGAAATTGATGCAGAATTAATTCTCTTAACTGCCCGCTTA
TGGCAAGCATTAGGCATTGAACAACACCTTTCTTTGCAATTAAACTCCAT
TGGTTCTTTAGCTGCTCGTGCTAATTATCGTGCAGCATTAGTAGATTTTT
TAGCAAATCATACCGCGTTAATGAATGATGAAGAAAAGGAACGTTTAGTT
AAAAATCCATTAAGAATTTTAGATACTAAAAATCAAGCTTTGCAAGCAGT
GTTAAATGATGCGCCTAAGTTATTAGATTATTTAGACGAAGAAAGTCGTC
AGCATTTTGCACAATTATGTCAGTTGCTAGATGCAATGGGAATTCGTTAT
GAAGTCAACCCAAAATTAGTACGCGGTTTAGATTATTATAATAAAACAGT
ATTTGAATGGGTTACCTCTGCTTTAGGTTCACAAGGTACCGTTTGTGGTG
GTGGCCGTTATGATGGCTTAGTTGAACAGCTTGGCGGACATGCAACCCAA
GGCGTTGGTTTTGCAATAGGATTAGAACGCTTAGTATTACTCGTTCAAGA
AGTAAATAAAACGATGAGTTTACCAAAAGCAGTTGATATTTATCTTGTTT
ATGCTGGCGATAATACAACGTTAAAGGCATTTCAAATTGCTGAGCAAATT
CGTAATGCATTACCGCAATTACGCGTGATGACACATTGTTCAGGCGGTAA
TTTTAAGAAACAGTTTAAGCGTGCAGATAAAGTCGAAGCTAAAATCGCAT
TGGTTATTGGTGAAAGTGAGCTCGCTACGCAAACAATAGTGCTAAAAGAG
TTACAAAACAGTAGTGAACAGATCAGCATCGATCAAGCCGATTTACTTGC
AGAATTATCAAAACGTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy