Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR747 IGR745 IGR748 IGR744 IGR743 IGR746 HD1034 HD1031 cysB, - HD1030 HD1036 gcpE, - HD1037 hisS, - HD1039 argH, - HD1033 uvrD, - HD1032 HD1034 HD1031 cysB, - HD1030 HD1036 gcpE, - HD1037 hisS, - HD1039 argH, - HD1033 uvrD, - HD1032 HD1034 HD1031 cysB, - HD1030 HD1036 gcpE, - HD1037 hisS, - HD1039 argH, - HD1033 uvrD, - HD1032 HD1029 HD1029
* Calculated from Protein Sequence

Gene ID: HD1033

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argH  

Definition:
argininosuccinate lyase

Gene Start:
823941

Gene Stop:
825317

Gene Length:
1377

Molecular Weight*:
51026

pI*:
5.90

Net Charge*:
-8.26

EC:
4.3.2.1  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Alanine and aspartate metabolism
Arginine and proline metabolism
Urea cycle and metabolism of amino groups

Secondary Evidence:
Parsot,C., Boyen,A., Cohen,G.N. and Glansdorff,N.
Nucleotide sequence of Escherichia coli argB and argC genes:
comparison of N-acetylglutamate kinase and
N-acetylglutamate-gamma-semialdehyde dehydrogenase with homologous
and analogous enzymes
Gene 68 (2), 275-283 (1988)
MEDLINE: 89121510

Troshina O, Hansel A, Lindblad P.
Cloning, characterization, and functional expression in Escherichia coli of argH encoding argininosuccinate lyase in the
cyanobacterium Nostoc sp. strain PCC 73102.
Curr Microbiol. 2001 Oct;43(4):260-4.
PMID: 11683360

Auchincloss AH, Loroch AI, Rochaix JD.
The argininosuccinate lyase gene of Chlamydomonas reinhardtii: cloning of the cDNA and its characterization as a
selectable shuttle marker.
Mol Gen Genet. 1999 Feb;261(1):21-30.
PMID: 10071206


Comment:
For other "arg" genes, see HD0892 (argD), HD1204 (argG), HD1384 (argA), HD0262 (argR), HD0890 (argC), HD0891 (argB).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to argininosuccinate lyase protein; e.g. residues 1-457 are 71% (Escore: 0.0) similar to sp|P44314|ARLY_HAEIN ARGININOSUCCINATE LYASE between positions 1 and 457 in Haemophilus influenzae Rd, residues 1-456 are 69% (EScore: 1e-179) similar to sp|P11447|ARLY_ECOLI ARGININOSUCCINATE LYASE between positions 1 and 456 in Escherichia coli, residues 1-456 are 65% similar to (AJ252020) argininosuccinase and n-acetylglutamate synthase of Moritella sp.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0165
COG name: Argininosuccinate lyase
Functional Class:  E
The phylogenetic pattern of COG0165 is amt-yq-cebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000362 (Fumarate lyase) with a combined E-value of 5.8e-15.
    IPB000362A    153-166
    IPB000362B    276-286


ProDom Summary:  Protein Domain Search
Residues 176-301 are 53% similar to a (LYASE FUMARATE HYDRATASE COMPLETE) protein domain (PD000660) which is seen in Q9JVG7_NEIMA.

Residues 303-445 are 76% similar to a (LYASE ARGININOSUCCINATE BIOSYNTHESIS) protein domain (PD040372) which is seen in ARLY_PASMU.

Residues 1-110 are 70% similar to a (LYASE ARGININOSUCCINATE BIOSYNTHESIS) protein domain (PD002682) which is seen in ARLY_PASMU.

Residues 198-297 are 82% similar to a (LYASE ARGININOSUCCINATE BIOSYNTHESIS) protein domain (PD254540) which is seen in ARLY_PASMU.

Residues 176-421 are 46% similar to a (LYASE ADENYLOSUCCINATE BIOSYNTHESIS) protein domain (PD328331) which is seen in ARLY_RAT.

Residues 118-167 are 70% similar to a (LYASE ARGININOSUCCINATE BIOSYNTHESIS) protein domain (PD403746) which is seen in ARLY_HAEIN.

Residues 111-172 are 54% similar to a (LYASE ARGININOSUCCINATE ARGININE) protein domain (PD406599) which is seen in ARLY_BACSU.



Paralogs:  Local Blast Search

HD1033 is paralogously related to HD0564 (1e-06) and HD1986 (1e-06).


Pfam Summary:  Pfam Search
Residues 6 to 301 (E-value = 6.1e-105) place HD1033 in the Lyase_1 family which is described as Lyase (PF00206)

PDB Hit:
pdb|1AUW|A Chain A, H91n Delta 2 Crystallin From Duck >gi|29817... 347 2e-096
pdb|1AOS|A Chain A, Human Argininosuccinate Lyase >gi|2914652|p... 333 3e-092
pdb|1DCN|D Chain D, Inactive Mutant H162n Of Delta 2 Crystallin... 310 2e-085

Gene Protein Sequence:
MALWGGRFQQEADAKFKFFNDSLRFDYRLALQDIDGSIGWAKAITAVGIL
TEAECAKLVDALKTLRAEIEPNIAIILRDAAEDIHSWVESKLIEKVGDLG
KKLHTGRSRNDQVALDMKMWCKVQVIVLQQCIRNLQHKLVATAEDNQQTI
MPGYTHLQRAQPISFAHWCMAYYEMLERDYTRLTDAYQRMHTCPLGCGAL
AGSAYPIDRDQLAQDLHFEIATRNSLDSVSDRDHLLELLASASISMVHLS
RFAEDLIFFNSGESAFLELSDRVTSGSSLMPQKKNPDACELIRGKSGRVF
GALSGLLTTLKGLPLAYNKDMQEDKEGIFDAVETWQACLEMATLVLEDIN
VNVVRTSEAAQQGYSNATELADYLVAKGIPFREAHHIVGETVVYAIQQRK
PLEALSVTEFKQFHSVIDQDVYAILSLPSCLAKRSAKGGVNPSRVKEAIE
VAKQHLAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACTTTGGGGTGGGCGTTTTCAGCAAGAAGCAGATGCAAAATTTAA
ATTTTTCAATGATTCATTACGTTTCGACTATCGTTTAGCGTTACAAGATA
TTGATGGCTCAATTGGTTGGGCCAAAGCCATTACGGCAGTTGGCATTTTA
ACTGAAGCAGAATGTGCCAAATTAGTGGATGCCTTAAAAACATTACGCGC
GGAAATTGAACCCAATATTGCAATTATTCTACGTGATGCAGCTGAAGACA
TTCATAGTTGGGTAGAATCTAAATTAATTGAAAAAGTCGGTGATCTAGGT
AAGAAATTACATACTGGCAGAAGCCGAAATGATCAAGTGGCATTAGATAT
GAAAATGTGGTGTAAAGTACAAGTAATCGTTTTACAGCAATGTATCCGTA
ACTTACAGCACAAATTAGTGGCAACGGCTGAAGATAATCAACAAACAATA
ATGCCCGGTTATACCCATTTACAACGAGCACAGCCGATTAGTTTTGCACA
TTGGTGTATGGCGTACTATGAGATGTTAGAACGTGATTACACCCGCTTAA
CAGATGCTTATCAGCGTATGCATACCTGTCCATTAGGTTGTGGTGCATTG
GCGGGAAGTGCTTATCCTATTGATCGGGATCAGTTAGCACAAGATCTTCA
TTTTGAGATTGCTACCCGTAATAGCTTGGATTCAGTGTCAGATCGTGATC
ACCTGTTAGAGTTACTTGCCAGTGCATCAATCAGTATGGTGCATTTGTCA
CGTTTTGCAGAAGATTTGATTTTCTTTAATAGTGGCGAATCTGCTTTTTT
GGAATTATCTGATCGTGTTACGTCCGGTTCTTCTTTAATGCCACAAAAGA
AAAACCCAGATGCTTGCGAATTAATTAGAGGCAAATCAGGGCGCGTATTT
GGGGCATTGTCTGGCTTATTAACCACGCTAAAAGGCTTGCCGTTAGCCTA
TAATAAAGATATGCAAGAAGATAAAGAAGGGATTTTTGATGCGGTCGAAA
CTTGGCAGGCCTGTTTAGAGATGGCTACTTTAGTTTTAGAAGATATTAAT
GTTAATGTTGTGCGTACGAGTGAGGCTGCCCAACAGGGCTATTCTAATGC
AACCGAATTAGCGGATTATTTAGTGGCTAAGGGTATTCCATTTCGTGAAG
CGCATCATATTGTTGGTGAAACAGTTGTTTATGCAATTCAACAACGCAAA
CCCTTGGAAGCATTATCTGTAACAGAATTTAAACAATTTCATTCAGTTAT
TGATCAAGATGTTTATGCCATTCTTTCTTTACCTTCTTGTTTGGCAAAAC
GCAGTGCTAAAGGCGGTGTTAACCCAAGCCGTGTGAAAGAAGCGATTGAA
GTAGCGAAGCAACATTTAGCAAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy