Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR745 IGR744 IGR743 IGR746 IGR741 HD1027 HD1034 HD1031 gcvA, - HD1028 cysB, - HD1030 HD1036 argH, - HD1033 uvrD, - HD1032 HD1027 HD1034 HD1031 gcvA, - HD1028 cysB, - HD1030 HD1036 argH, - HD1033 uvrD, - HD1032 HD1027 HD1034 HD1031 gcvA, - HD1028 cysB, - HD1030 HD1036 argH, - HD1033 uvrD, - HD1032 HD1029 HD1029
* Calculated from Protein Sequence

Gene ID: HD1032

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
uvrD  

Definition:
DNA helicase II

Gene Start:
821592

Gene Stop:
823781

Gene Length:
2190

Molecular Weight*:
83238

pI*:
7.00

Net Charge*:
0.00

EC:
3.6.1.-  3.6.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Purine metabolism
Starch and sucrose metabolism

Secondary Evidence:
Walter,R.B., Morton,K.A. and Stuy,J.H.
The sequence of the Haemophilus influenzae mutB gene indicates it
encodes a DNA helicase II-like protein
Gene 136 (1-2), 35-40 (1993)
Medline: 94124030

Yamamoto,Y., Ogawa,T., Shinagawa,H., Nakayama,T., Matsuo,H. and
Ogawa,H.
Determination of the initiation sites of transcription and
translation of the uvrD gene of Escherichia coli
J. Biochem. 99 (6), 1579-1590 (1986)
Medline: 86304220

Easton,A.M. and Kushner,S.R.
Transcription of the uvrD gene of Escherichia coli is controlled by the lexA repressor and by attenuation
Nucleic Acids Res. 11 (24), 8625-8640 (1983)
Medline: 84169504


Comment:
This protein may process damage occurring in nonreplicating regions of DNA to produce recombinational intermediates for sister strand recombinational exchange.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to DNA helicase II protein; e.g. residues 1-729 are 74% similar to DNA helicase II in

Residues 1-726 are 66% similar to DNA helicase II in Escherichia coli (137194).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0210
COG name: Superfamily I DNA and RNA helicases
Functional Class: L
The phylogenetic pattern of COG0210 is --T-YqvCEBRHUJgPOLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000212 (UvrD/REP helicase) with a combined E-value of 2e-74.
    IPB000212A    29-39
    IPB000212B    57-74
    IPB000212C    223-234
    IPB000212D    250-263
    IPB000212E    283-301
    IPB000212F    558-576
    IPB000212G    597-609


ProDom Summary:  Protein Domain Search
Residues 679-728 are 70% similar to a (HELICASE DNA II PROTEOME) protein domain (PD011354) which is seen in Q9CNL7_PASMU.

Residues 558-652 are 79% similar to a (HELICASE DNA COMPLETE PROTEOME ATP-DEPENDENT ATP-BINDING) protein domain (PD002094) which is seen in Q9CNL7_PASMU.

Residues 10-75 are 86% similar to a (HELICASE DNA PROTEOME COMPLETE ATP-BINDING DNA-BINDING) protein domain (PD000627) which is seen in Q9CNL7_PASMU.

Residues 376-543 are 74% similar to a (HELICASE DNA PROTEOME COMPLETE) protein domain (PD003735) which is seen in UVRD_HAEIN.

Residues 221-333 are 36% similar to a (HELICASE COMPLETE PROTEOME DNA) protein domain (PD126505) which is seen in Q9RGW0_SALTI.

Residues 88-171 are 55% similar to a (HELICASE DNA II PROTEOME) protein domain (PD310960) which is seen in UVRD_ECOLI.

Residues 83-372 are 71% similar to a (HELICASE DNA PROTEOME COMPLETE) protein domain (PD001658) which is seen in UVRD_HAEIN.

Residues 433-550 are 33% similar to a (PROTEOME COMPLETE HELICASE II) protein domain (PD397049) which is seen in Q9PH94_XYLFA.



Paralogs:  Local Blast Search
HD1032 is paralogously related to HD0571 (1e-118), HD1076 (9e-10) and HD0186 (0.001).


Pfam Summary:  Pfam Search
Residues 10 to 494 (E-value = 6.3e-219) place HD1032 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

PDB Hit:
pdb|3PJR|A Chain A, Helicase Substrate Complex >gi|2781090|pdb|... 521 1e-148
pdb|1UAA|B Chain B, Structure Of The Rep Helicase-Single Strand... 396 4e-111
pdb|2PJR|A Chain A, Helicase Product Complex >gi|9257173|pdb|2P... 393 5e-110

Gene Protein Sequence:
MDFSLLLDGLNDKQRQAVSAPLGNYLVLAGAGSGKTRVLTHRIAWLMRVE
HISEASILAVTFTNKAAAEMRNRIEYTLSMSSQHRLFGMWVGTFHSIAHR
LLRSHYLDANLPQDFQIMDTEDQLRLLKRLLKLHNFDEKYFPPKQVAWYI
NAQKDKGMRAKDINHHNDANEKKLIQIYQIYQEACDRAGLLDFAELLIRA
YELFKNNRVILERYQHRFQQILIDEFQDTNHIQYDLIQLLAGKTGNVVIV
GDDDQSIYGWRGAQVENIQRFLQDYRQAQTIRLEQNYRSTGHILASANQL
IANNNDRLGKNLWTDKGDGDPVDIYCAFNELDEARFVASQIKQWKEEQGS
LNDCAILYRSNSQSRVIEEALIQANIPYRIYGGMRFFERQEIKDALAYLR
LISNRDDDAAFERVINTPPRGIGDRTLEGLRQLTRSRQVTLWQAVQIAIQ
EQHLSARAASALLRFVELINALEQETTQMSLCEQTDFVIKTSGLYEMYKQ
EKGEKGEVRIENLAELVTATKEFCKPDDAIELSDLTAFLTHASLEAGENQ
ASLHQDYVELMTLHAAKGLEFPRVFIVGMEEGLFPSGISFDEGRLPEERR
LAYVGITRAKQRLTISYAELRRLYGKEERHIASRFIAELPAEHIREVRLR
GSINRAASFTQSGAHSIKTTANCLADSEWQMGQKVNHAKFGQGTVINVEG
SGDATRLQIAFAGNGIKWLIAKMANLVKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTTTCTTTATTATTAGATGGATTGAATGATAAACAACGGCAGGC
AGTTTCAGCACCTTTAGGTAATTATTTAGTGCTTGCAGGGGCAGGCTCTG
GCAAAACGCGGGTATTAACGCATAGAATTGCTTGGTTAATGAGAGTTGAA
CATATATCAGAAGCGAGTATTTTAGCGGTCACTTTTACCAATAAAGCCGC
AGCCGAAATGCGAAACCGTATTGAATATACCTTATCAATGAGTAGCCAAC
ATCGTTTATTTGGTATGTGGGTGGGCACTTTCCATAGTATTGCACATAGG
TTGCTTCGTTCGCATTATCTTGATGCAAATTTGCCACAAGATTTTCAAAT
TATGGATACAGAAGATCAATTACGGTTACTAAAACGTTTATTGAAGTTAC
ATAATTTTGATGAAAAATATTTCCCGCCAAAGCAAGTCGCTTGGTATATC
AATGCACAAAAAGATAAAGGAATGCGGGCAAAGGATATAAATCACCATAA
CGATGCTAATGAGAAAAAGTTAATCCAAATTTATCAAATTTATCAAGAGG
CTTGTGATCGTGCAGGTTTATTAGACTTTGCTGAATTATTAATTCGTGCT
TATGAATTATTTAAAAATAACCGAGTGATTTTAGAGCGTTATCAACACCG
CTTTCAGCAAATTTTAATTGACGAATTTCAAGACACTAACCATATTCAAT
ATGATTTGATTCAGCTACTTGCGGGTAAAACCGGCAATGTGGTGATTGTT
GGTGATGATGATCAATCCATTTATGGCTGGCGAGGTGCACAAGTTGAAAA
TATTCAACGCTTTTTGCAAGATTATCGTCAAGCACAAACAATTCGTTTAG
AGCAAAATTATCGTTCTACAGGCCATATTCTGGCATCAGCTAATCAATTA
ATTGCCAACAATAATGACCGCTTAGGCAAAAATCTTTGGACAGATAAAGG
CGACGGCGACCCCGTTGATATTTACTGTGCATTTAACGAATTAGATGAGG
CACGCTTTGTTGCATCGCAGATCAAACAGTGGAAAGAAGAGCAAGGTAGC
TTAAATGATTGTGCGATACTTTACCGTAGTAATAGCCAATCACGCGTCAT
TGAAGAAGCCTTAATTCAGGCGAATATTCCTTATCGAATTTATGGCGGAA
TGCGTTTTTTTGAACGGCAAGAAATTAAAGATGCGTTAGCTTATTTACGT
TTGATCAGCAATCGTGATGATGATGCAGCATTTGAGAGAGTGATTAATAC
ACCGCCAAGAGGCATAGGCGATCGCACATTGGAAGGATTGCGTCAATTGA
CTCGTAGCCGGCAAGTAACGCTATGGCAAGCGGTTCAAATTGCTATTCAA
GAACAACATCTCTCTGCGCGTGCTGCCTCCGCATTGTTGCGTTTTGTTGA
ACTGATTAATGCGCTTGAGCAAGAAACCACGCAAATGTCACTCTGTGAAC
AAACTGATTTTGTGATTAAAACATCAGGTTTATACGAGATGTATAAACAA
GAAAAAGGCGAAAAGGGCGAAGTGCGGATTGAAAACTTAGCAGAGCTTGT
TACTGCCACCAAAGAGTTTTGCAAGCCTGATGATGCAATTGAGCTATCAG
ATCTGACCGCTTTCCTAACGCATGCATCACTAGAAGCGGGAGAAAATCAA
GCATCACTGCACCAAGATTATGTTGAATTAATGACATTACATGCAGCAAA
AGGGCTAGAGTTTCCAAGAGTCTTTATCGTGGGAATGGAAGAAGGTCTTT
TCCCTAGTGGCATCAGTTTTGATGAAGGCCGATTACCAGAAGAACGTCGT
TTAGCTTATGTAGGTATCACGCGTGCTAAGCAAAGACTTACCATTAGTTA
TGCAGAATTACGCCGCTTATATGGCAAAGAAGAACGGCATATCGCTTCCC
GCTTTATTGCTGAGTTACCTGCTGAACATATCCGAGAAGTCCGTTTGCGC
GGCAGTATCAATCGTGCTGCAAGTTTCACGCAATCTGGCGCTCATTCAAT
AAAAACAACCGCTAATTGCTTAGCTGATAGTGAGTGGCAAATGGGGCAAA
AAGTCAATCACGCTAAGTTTGGACAAGGCACGGTGATTAATGTTGAAGGT
AGTGGTGATGCGACACGGTTACAAATTGCTTTTGCTGGCAATGGAATTAA
ATGGTTGATCGCCAAGATGGCAAATTTAGTCAAGTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy